Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CX27

Protein Details
Accession P0CX27    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0046677  P:response to antibiotic  
GO:0046898  P:response to cycloheximide  
KEGG sce:YHR141C  -  
sce:YNL162W  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.89
5 0.88
6 0.89
7 0.89
8 0.9
9 0.88
10 0.89
11 0.89
12 0.82
13 0.82
14 0.76
15 0.7
16 0.62
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.28
46 0.33
47 0.38
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.66
57 0.63
58 0.64
59 0.64
60 0.62
61 0.58
62 0.54
63 0.51
64 0.49
65 0.5
66 0.48
67 0.5
68 0.53
69 0.58
70 0.63
71 0.71
72 0.74
73 0.72
74 0.67
75 0.62
76 0.58
77 0.52
78 0.5
79 0.5
80 0.51
81 0.55
82 0.62
83 0.59
84 0.59
85 0.61
86 0.57