Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TD20

Protein Details
Accession A0A0A1TD20    Localization Confidence High Confidence Score 25
NoLS Segment(s)
PositionSequenceProtein Nature
63-85GKVAPPKPTVSPKPQKRRSDVLPHydrophilic
343-369GLPLKVFKKKGQKRTTRISNMKPMQKMHydrophilic
385-407DEDDKDDKPKKPRKVNELAHANFBasic
NLS Segment(s)
PositionSequence
351-355KKGQK
392-430KPKKPRKVNELAHANFKRLKLRSKGGKGGPSFGGRFRRR
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006270  P:DNA replication initiation  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
Amino Acid Sequences MDDNTRAKYEEKAKEARASLKKWENDWADGHNGAKPGRQDIKDHPDIALQYKEYNKIREILAGKVAPPKPTVSPKPQKRRSDVLPAQTPVKRSRLTETPSKPALGADLMMNSPAISRKLFSPAPVTSIGPTPQRDGRVLGLFDLLVDKELGSPSKGSMMSPSKPRSNINATPSKKRSAVDEIALGRTPKSNSNRNSTFMTPLKKRDDNAGGRTPGSISKTLQFDTPAFLKRHSLPAVLENAADLPAPPLRLPRKPIVRGLSEIVASLRKVEDDQLDEDLEALREMENEEMGEGATSLPQLPKLKPVSPDASILEKDSQALPLGGFDDEGMYDSSDEEQLGRDGLPLKVFKKKGQKRTTRISNMKPMQKMRPAALDENGNIIEGADEDDKDDKPKKPRKVNELAHANFKRLKLRSKGGKGGPSFGGRFRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.65
4 0.64
5 0.59
6 0.61
7 0.63
8 0.63
9 0.58
10 0.63
11 0.57
12 0.53
13 0.52
14 0.46
15 0.41
16 0.38
17 0.37
18 0.31
19 0.3
20 0.26
21 0.27
22 0.25
23 0.29
24 0.35
25 0.36
26 0.39
27 0.45
28 0.54
29 0.56
30 0.55
31 0.48
32 0.43
33 0.43
34 0.42
35 0.37
36 0.28
37 0.27
38 0.3
39 0.37
40 0.38
41 0.4
42 0.37
43 0.36
44 0.36
45 0.38
46 0.37
47 0.32
48 0.33
49 0.31
50 0.31
51 0.36
52 0.38
53 0.33
54 0.32
55 0.32
56 0.32
57 0.4
58 0.46
59 0.48
60 0.57
61 0.65
62 0.75
63 0.82
64 0.85
65 0.83
66 0.83
67 0.79
68 0.79
69 0.75
70 0.73
71 0.7
72 0.63
73 0.63
74 0.57
75 0.54
76 0.48
77 0.48
78 0.41
79 0.36
80 0.4
81 0.42
82 0.44
83 0.51
84 0.51
85 0.52
86 0.51
87 0.5
88 0.44
89 0.36
90 0.32
91 0.23
92 0.18
93 0.11
94 0.11
95 0.1
96 0.1
97 0.1
98 0.08
99 0.08
100 0.09
101 0.1
102 0.09
103 0.1
104 0.12
105 0.18
106 0.18
107 0.19
108 0.23
109 0.22
110 0.25
111 0.25
112 0.24
113 0.2
114 0.21
115 0.22
116 0.21
117 0.22
118 0.22
119 0.24
120 0.25
121 0.25
122 0.25
123 0.26
124 0.25
125 0.24
126 0.21
127 0.18
128 0.15
129 0.14
130 0.13
131 0.09
132 0.06
133 0.06
134 0.05
135 0.06
136 0.07
137 0.07
138 0.07
139 0.08
140 0.08
141 0.12
142 0.12
143 0.11
144 0.17
145 0.21
146 0.24
147 0.32
148 0.36
149 0.36
150 0.39
151 0.4
152 0.4
153 0.43
154 0.45
155 0.44
156 0.49
157 0.48
158 0.55
159 0.56
160 0.54
161 0.48
162 0.43
163 0.4
164 0.38
165 0.38
166 0.3
167 0.31
168 0.29
169 0.27
170 0.28
171 0.24
172 0.16
173 0.16
174 0.16
175 0.19
176 0.23
177 0.3
178 0.33
179 0.41
180 0.43
181 0.44
182 0.46
183 0.41
184 0.41
185 0.37
186 0.4
187 0.35
188 0.38
189 0.42
190 0.4
191 0.4
192 0.4
193 0.44
194 0.42
195 0.45
196 0.44
197 0.38
198 0.36
199 0.36
200 0.3
201 0.24
202 0.21
203 0.17
204 0.12
205 0.15
206 0.16
207 0.17
208 0.17
209 0.16
210 0.14
211 0.15
212 0.17
213 0.19
214 0.18
215 0.18
216 0.2
217 0.2
218 0.25
219 0.24
220 0.23
221 0.18
222 0.21
223 0.23
224 0.2
225 0.19
226 0.13
227 0.12
228 0.11
229 0.1
230 0.07
231 0.05
232 0.06
233 0.06
234 0.07
235 0.13
236 0.17
237 0.2
238 0.25
239 0.31
240 0.39
241 0.42
242 0.48
243 0.46
244 0.45
245 0.44
246 0.41
247 0.35
248 0.26
249 0.23
250 0.18
251 0.14
252 0.12
253 0.1
254 0.08
255 0.07
256 0.08
257 0.1
258 0.11
259 0.12
260 0.14
261 0.14
262 0.14
263 0.14
264 0.14
265 0.12
266 0.1
267 0.07
268 0.06
269 0.05
270 0.05
271 0.06
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.05
284 0.05
285 0.1
286 0.13
287 0.14
288 0.21
289 0.25
290 0.29
291 0.31
292 0.36
293 0.36
294 0.35
295 0.37
296 0.32
297 0.32
298 0.28
299 0.28
300 0.24
301 0.2
302 0.19
303 0.17
304 0.15
305 0.12
306 0.12
307 0.1
308 0.08
309 0.09
310 0.08
311 0.08
312 0.07
313 0.06
314 0.06
315 0.07
316 0.07
317 0.06
318 0.06
319 0.07
320 0.08
321 0.08
322 0.08
323 0.07
324 0.08
325 0.08
326 0.08
327 0.08
328 0.09
329 0.11
330 0.12
331 0.16
332 0.18
333 0.21
334 0.29
335 0.32
336 0.37
337 0.46
338 0.55
339 0.62
340 0.69
341 0.77
342 0.76
343 0.84
344 0.88
345 0.88
346 0.87
347 0.85
348 0.85
349 0.83
350 0.82
351 0.79
352 0.74
353 0.71
354 0.7
355 0.65
356 0.58
357 0.57
358 0.54
359 0.5
360 0.47
361 0.43
362 0.36
363 0.36
364 0.32
365 0.25
366 0.2
367 0.16
368 0.13
369 0.09
370 0.12
371 0.09
372 0.09
373 0.1
374 0.13
375 0.14
376 0.2
377 0.26
378 0.3
379 0.4
380 0.49
381 0.58
382 0.67
383 0.76
384 0.8
385 0.85
386 0.86
387 0.86
388 0.87
389 0.8
390 0.8
391 0.72
392 0.67
393 0.6
394 0.55
395 0.54
396 0.48
397 0.55
398 0.52
399 0.61
400 0.67
401 0.71
402 0.77
403 0.76
404 0.79
405 0.72
406 0.69
407 0.63
408 0.59
409 0.52
410 0.5