Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13549

Protein Details
Accession O13549   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-42TKVIYQMKGKSQPKRERKKQNYWVLKSLHydrophilic
NLS Segment(s)
PositionSequence
26-33QPKRERKK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
Gene Ontology GO:0006623  P:protein targeting to vacuole  
KEGG sce:YLR261C  -  
Amino Acid Sequences MKEVTKMLYCALLVTKVIYQMKGKSQPKRERKKQNYWVLKSLWKRPQRQAIMSKLYSKRLPNRCLNFKTASQLLWIAKMQIVQTKINRESLIFLQQRSRNKALVSVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.17
4 0.19
5 0.19
6 0.21
7 0.23
8 0.3
9 0.39
10 0.45
11 0.48
12 0.57
13 0.66
14 0.74
15 0.82
16 0.84
17 0.86
18 0.88
19 0.91
20 0.91
21 0.91
22 0.91
23 0.85
24 0.79
25 0.71
26 0.69
27 0.62
28 0.61
29 0.59
30 0.56
31 0.56
32 0.58
33 0.64
34 0.62
35 0.63
36 0.61
37 0.59
38 0.57
39 0.53
40 0.53
41 0.45
42 0.44
43 0.41
44 0.39
45 0.42
46 0.44
47 0.49
48 0.51
49 0.56
50 0.61
51 0.61
52 0.61
53 0.55
54 0.48
55 0.47
56 0.39
57 0.32
58 0.24
59 0.25
60 0.2
61 0.19
62 0.18
63 0.14
64 0.14
65 0.15
66 0.14
67 0.15
68 0.17
69 0.2
70 0.24
71 0.31
72 0.32
73 0.34
74 0.34
75 0.3
76 0.31
77 0.3
78 0.35
79 0.3
80 0.3
81 0.35
82 0.4
83 0.48
84 0.52
85 0.52
86 0.46
87 0.44
88 0.49