Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P38912

Protein Details
Accession P38912    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKKNTKGGKKGRRGKNDSDGPKREBasic
NLS Segment(s)
PositionSequence
3-17KKNTKGGKKGRRGKN
Subcellular Location(s) nucl 20, cyto_nucl 11.833, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006196  RNA-binding_domain_S1_IF1  
IPR001253  TIF_eIF-1A  
IPR018104  TIF_eIF-1A_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0010494  C:cytoplasmic stress granule  
GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0003725  F:double-stranded RNA binding  
GO:0019901  F:protein kinase binding  
GO:0043024  F:ribosomal small subunit binding  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
GO:0001677  P:formation of translation initiation ternary complex  
GO:0001731  P:formation of translation preinitiation complex  
GO:0002188  P:translation reinitiation  
GO:0006413  P:translational initiation  
KEGG sce:YMR260C  -  
Pfam View protein in Pfam  
PF01176  eIF-1a  
PROSITE View protein in PROSITE  
PS01262  IF1A  
PS50832  S1_IF1_TYPE  
CDD cd05793  S1_IF1A  
Amino Acid Sequences MGKKNTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINETDNFGFESDEDVNFEFGNADEDDEEGEDEELDIDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.85
4 0.84
5 0.83
6 0.83
7 0.78
8 0.71
9 0.68
10 0.6
11 0.56
12 0.49
13 0.43
14 0.41
15 0.39
16 0.38
17 0.36
18 0.35
19 0.3
20 0.3
21 0.27
22 0.21
23 0.19
24 0.15
25 0.13
26 0.14
27 0.16
28 0.15
29 0.17
30 0.16
31 0.16
32 0.17
33 0.17
34 0.16
35 0.14
36 0.16
37 0.15
38 0.15
39 0.15
40 0.19
41 0.2
42 0.2
43 0.23
44 0.22
45 0.24
46 0.28
47 0.34
48 0.38
49 0.46
50 0.53
51 0.57
52 0.56
53 0.59
54 0.58
55 0.57
56 0.55
57 0.51
58 0.46
59 0.41
60 0.4
61 0.33
62 0.29
63 0.22
64 0.14
65 0.08
66 0.06
67 0.06
68 0.05
69 0.06
70 0.06
71 0.06
72 0.11
73 0.12
74 0.12
75 0.11
76 0.13
77 0.13
78 0.14
79 0.16
80 0.11
81 0.12
82 0.16
83 0.17
84 0.16
85 0.17
86 0.18
87 0.23
88 0.24
89 0.25
90 0.21
91 0.23
92 0.25
93 0.25
94 0.28
95 0.23
96 0.25
97 0.29
98 0.29
99 0.25
100 0.24
101 0.23
102 0.2
103 0.21
104 0.21
105 0.16
106 0.16
107 0.17
108 0.16
109 0.16
110 0.14
111 0.15
112 0.13
113 0.12
114 0.13
115 0.12
116 0.13
117 0.12
118 0.12
119 0.09
120 0.08
121 0.1
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.1
128 0.1
129 0.08
130 0.08
131 0.07
132 0.07
133 0.07