Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TFR8

Protein Details
Accession A0A0A1TFR8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-84HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLFRAFALTTRTWARPAVVGTAFTKAAAPGTPLFANAVNSIVRTSSIVQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.23
5 0.23
6 0.24
7 0.21
8 0.21
9 0.2
10 0.22
11 0.2
12 0.17
13 0.16
14 0.11
15 0.11
16 0.09
17 0.1
18 0.08
19 0.11
20 0.11
21 0.11
22 0.12
23 0.12
24 0.12
25 0.1
26 0.11
27 0.08
28 0.09
29 0.09
30 0.08
31 0.07
32 0.07
33 0.08
34 0.11
35 0.17
36 0.18
37 0.19
38 0.23
39 0.25
40 0.27
41 0.27
42 0.23
43 0.18
44 0.2
45 0.28
46 0.31
47 0.37
48 0.39
49 0.46
50 0.53
51 0.57
52 0.63
53 0.62
54 0.65
55 0.67
56 0.72
57 0.75
58 0.78
59 0.81
60 0.81
61 0.81
62 0.82
63 0.83
64 0.83
65 0.8
66 0.79
67 0.77
68 0.72
69 0.67
70 0.64
71 0.57
72 0.5
73 0.43
74 0.35
75 0.35
76 0.39
77 0.45
78 0.48
79 0.54