Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1THE7

Protein Details
Accession A0A0A1THE7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-41ASSARIKKNKKAQSVKFKVRCQHydrophilic
NLS Segment(s)
PositionSequence
23-30ARIKKNKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEVADIKKFIEICRRKDASSARIKKNKKAQSVKFKVRCQKNLYTLVLKDSDKAEKLKQSLPPNLQITDVSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.46
3 0.48
4 0.45
5 0.51
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.66
12 0.69
13 0.71
14 0.75
15 0.73
16 0.72
17 0.73
18 0.73
19 0.75
20 0.81
21 0.83
22 0.81
23 0.8
24 0.78
25 0.75
26 0.73
27 0.68
28 0.65
29 0.61
30 0.6
31 0.56
32 0.51
33 0.44
34 0.4
35 0.37
36 0.31
37 0.25
38 0.22
39 0.22
40 0.21
41 0.23
42 0.25
43 0.27
44 0.31
45 0.34
46 0.4
47 0.44
48 0.5
49 0.51
50 0.55
51 0.53
52 0.5
53 0.47
54 0.41
55 0.39