Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1SX14

Protein Details
Accession A0A0A1SX14   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-88STLLAHRKGKPHKRRLKQLREELETAHydrophilic
NLS Segment(s)
PositionSequence
69-80RKGKPHKRRLKQ
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGVLSQRTITKTRRKIRDFDQVKADLISSKSLEKFKDSKAAEDLPDLGRNYCVECARWFNAESTLLAHRKGKPHKRRLKQLREELETARIPGGGSSKRSTEASAETATTTDDVTMAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.74
4 0.77
5 0.71
6 0.66
7 0.64
8 0.55
9 0.51
10 0.45
11 0.38
12 0.3
13 0.26
14 0.23
15 0.16
16 0.17
17 0.2
18 0.22
19 0.23
20 0.25
21 0.28
22 0.28
23 0.35
24 0.33
25 0.32
26 0.34
27 0.35
28 0.3
29 0.27
30 0.27
31 0.2
32 0.22
33 0.2
34 0.16
35 0.14
36 0.14
37 0.14
38 0.14
39 0.13
40 0.11
41 0.12
42 0.16
43 0.16
44 0.18
45 0.17
46 0.15
47 0.16
48 0.16
49 0.14
50 0.13
51 0.15
52 0.15
53 0.15
54 0.18
55 0.19
56 0.27
57 0.36
58 0.45
59 0.51
60 0.62
61 0.71
62 0.77
63 0.85
64 0.89
65 0.9
66 0.9
67 0.89
68 0.86
69 0.81
70 0.75
71 0.65
72 0.6
73 0.49
74 0.4
75 0.3
76 0.22
77 0.16
78 0.15
79 0.18
80 0.16
81 0.19
82 0.21
83 0.22
84 0.25
85 0.26
86 0.26
87 0.24
88 0.24
89 0.24
90 0.23
91 0.22
92 0.2
93 0.19
94 0.19
95 0.16
96 0.12
97 0.09