Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1TC11

Protein Details
Accession A0A0A1TC11    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
615-660PKSTAAPPKDTKKPPPPPPKTNPPKQTPPPKQAPPPKQTPPPKNTGHydrophilic
NLS Segment(s)
PositionSequence
561-688PKDTKKSGAPKNTSPPPPPKTTAAPPKDTPKPPPPPPKSTAAPPKDTPKPPPPPPKSTAAPPKDTKKPPPPPPKTNPPKQTPPPKQAPPPKQTPPPKNTGGGGKVCKRRGKGGGGGGRSGGGGRTGGG
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MRCEALFAVLVPLLGAAPVFAMAQDFDTQDMAAIAAALNMQLDGAGADYALTKRDLRRSLEPICSSAAPDSDAAKFCAGLTNIVSSVNGAIGAGTVVGAGAPSGQPTPAPAAQPTAAQPPPVEGQPPVEGQPPTEGQPPADQTPVLGPDGQPIPVQPANVTVPTNGTAPLPDGGTPAPDGTAPVPPVDSPTLVPGEGPDQEQPGENGPEAGGGALGKTDAPAPTDAPVQGGGTGSNIGQIVGGLGTLVQGVGDIITAIKGNGGGNGEGEAPPAATPAPGNESQGNPAQAPGAGNTAPVASQAPPAASQAPPAAGSQAPAASQAPAAGSQAPPAASQAPPAAGSQAPVASQAPAVSQPAVSQPAASQAPAVSKPAGSEPPVSKPAASEPIKSEAPKPSAPAAGASSKPAVSEPIKSEAPKPSAPGAVASSKPTVSEAPKTSAPGAVASSKPAASQPIKSEALKSEPIKASQPPPAASATKKPTFGSANPSGAETPKSTVKPNEPPKVSSQPPKAASSAPAVKPSEPAVKPSEPIKPSEPIKPSGPPAGKPTTFSTQIRSQPPKDTKKSGAPKNTSPPPPPKTTAAPPKDTPKPPPPPPKSTAAPPKDTPKPPPPPPKSTAAPPKDTKKPPPPPPKTNPPKQTPPPKQAPPPKQTPPPKNTGGGGKVCKRRGKGGGGGGRSGGGGRTGGGSSSGGRKGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.04
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.08
11 0.09
12 0.1
13 0.1
14 0.11
15 0.11
16 0.1
17 0.1
18 0.08
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.03
31 0.04
32 0.04
33 0.04
34 0.04
35 0.06
36 0.07
37 0.09
38 0.11
39 0.14
40 0.19
41 0.28
42 0.34
43 0.38
44 0.46
45 0.52
46 0.56
47 0.62
48 0.59
49 0.52
50 0.5
51 0.44
52 0.38
53 0.32
54 0.26
55 0.19
56 0.18
57 0.18
58 0.19
59 0.2
60 0.2
61 0.19
62 0.18
63 0.16
64 0.21
65 0.19
66 0.17
67 0.17
68 0.17
69 0.17
70 0.17
71 0.17
72 0.12
73 0.11
74 0.09
75 0.08
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.02
87 0.03
88 0.03
89 0.05
90 0.06
91 0.06
92 0.06
93 0.08
94 0.14
95 0.16
96 0.17
97 0.17
98 0.2
99 0.21
100 0.23
101 0.23
102 0.25
103 0.23
104 0.22
105 0.21
106 0.21
107 0.23
108 0.22
109 0.22
110 0.15
111 0.18
112 0.2
113 0.22
114 0.2
115 0.22
116 0.22
117 0.21
118 0.24
119 0.22
120 0.22
121 0.26
122 0.25
123 0.21
124 0.26
125 0.29
126 0.27
127 0.27
128 0.24
129 0.19
130 0.21
131 0.22
132 0.18
133 0.15
134 0.13
135 0.16
136 0.18
137 0.18
138 0.15
139 0.13
140 0.18
141 0.19
142 0.19
143 0.15
144 0.17
145 0.19
146 0.2
147 0.21
148 0.15
149 0.15
150 0.16
151 0.17
152 0.14
153 0.11
154 0.1
155 0.11
156 0.11
157 0.1
158 0.09
159 0.1
160 0.1
161 0.1
162 0.11
163 0.09
164 0.09
165 0.08
166 0.09
167 0.09
168 0.12
169 0.11
170 0.11
171 0.12
172 0.11
173 0.14
174 0.14
175 0.14
176 0.11
177 0.13
178 0.14
179 0.13
180 0.13
181 0.11
182 0.12
183 0.12
184 0.13
185 0.11
186 0.12
187 0.12
188 0.13
189 0.13
190 0.14
191 0.14
192 0.13
193 0.12
194 0.11
195 0.1
196 0.1
197 0.09
198 0.05
199 0.04
200 0.04
201 0.03
202 0.04
203 0.03
204 0.04
205 0.05
206 0.05
207 0.07
208 0.08
209 0.09
210 0.1
211 0.12
212 0.12
213 0.11
214 0.11
215 0.1
216 0.09
217 0.09
218 0.07
219 0.06
220 0.07
221 0.06
222 0.07
223 0.06
224 0.06
225 0.05
226 0.05
227 0.05
228 0.04
229 0.04
230 0.03
231 0.02
232 0.02
233 0.03
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.03
243 0.03
244 0.03
245 0.03
246 0.04
247 0.04
248 0.06
249 0.07
250 0.06
251 0.07
252 0.08
253 0.08
254 0.07
255 0.08
256 0.06
257 0.06
258 0.05
259 0.06
260 0.05
261 0.04
262 0.04
263 0.05
264 0.09
265 0.09
266 0.12
267 0.13
268 0.13
269 0.16
270 0.18
271 0.18
272 0.14
273 0.14
274 0.12
275 0.11
276 0.11
277 0.09
278 0.09
279 0.07
280 0.07
281 0.07
282 0.07
283 0.06
284 0.06
285 0.07
286 0.05
287 0.07
288 0.07
289 0.07
290 0.08
291 0.09
292 0.1
293 0.09
294 0.09
295 0.09
296 0.09
297 0.09
298 0.09
299 0.09
300 0.08
301 0.08
302 0.08
303 0.08
304 0.07
305 0.07
306 0.07
307 0.06
308 0.06
309 0.06
310 0.06
311 0.05
312 0.06
313 0.06
314 0.06
315 0.06
316 0.07
317 0.07
318 0.07
319 0.07
320 0.09
321 0.08
322 0.09
323 0.09
324 0.08
325 0.09
326 0.09
327 0.09
328 0.08
329 0.08
330 0.08
331 0.07
332 0.07
333 0.07
334 0.07
335 0.06
336 0.06
337 0.06
338 0.05
339 0.06
340 0.06
341 0.06
342 0.05
343 0.06
344 0.07
345 0.09
346 0.09
347 0.08
348 0.08
349 0.12
350 0.12
351 0.11
352 0.1
353 0.08
354 0.1
355 0.11
356 0.12
357 0.08
358 0.08
359 0.09
360 0.11
361 0.12
362 0.11
363 0.15
364 0.15
365 0.19
366 0.22
367 0.21
368 0.19
369 0.18
370 0.19
371 0.24
372 0.24
373 0.22
374 0.21
375 0.26
376 0.27
377 0.27
378 0.28
379 0.25
380 0.28
381 0.26
382 0.26
383 0.24
384 0.23
385 0.23
386 0.21
387 0.18
388 0.16
389 0.16
390 0.15
391 0.14
392 0.13
393 0.13
394 0.12
395 0.13
396 0.11
397 0.14
398 0.16
399 0.19
400 0.21
401 0.22
402 0.25
403 0.27
404 0.3
405 0.27
406 0.27
407 0.24
408 0.24
409 0.23
410 0.22
411 0.18
412 0.17
413 0.17
414 0.17
415 0.16
416 0.15
417 0.15
418 0.15
419 0.15
420 0.14
421 0.2
422 0.2
423 0.23
424 0.24
425 0.25
426 0.25
427 0.23
428 0.21
429 0.16
430 0.15
431 0.14
432 0.13
433 0.13
434 0.14
435 0.12
436 0.12
437 0.12
438 0.16
439 0.15
440 0.18
441 0.2
442 0.25
443 0.27
444 0.27
445 0.29
446 0.26
447 0.28
448 0.31
449 0.29
450 0.3
451 0.29
452 0.31
453 0.31
454 0.33
455 0.32
456 0.32
457 0.35
458 0.28
459 0.28
460 0.29
461 0.29
462 0.28
463 0.32
464 0.33
465 0.34
466 0.34
467 0.33
468 0.34
469 0.36
470 0.35
471 0.36
472 0.34
473 0.33
474 0.31
475 0.32
476 0.29
477 0.25
478 0.25
479 0.18
480 0.16
481 0.19
482 0.2
483 0.23
484 0.27
485 0.33
486 0.41
487 0.49
488 0.56
489 0.53
490 0.54
491 0.57
492 0.6
493 0.59
494 0.58
495 0.56
496 0.54
497 0.55
498 0.55
499 0.5
500 0.43
501 0.4
502 0.38
503 0.38
504 0.32
505 0.34
506 0.33
507 0.32
508 0.32
509 0.34
510 0.36
511 0.29
512 0.31
513 0.31
514 0.31
515 0.32
516 0.34
517 0.39
518 0.31
519 0.35
520 0.34
521 0.35
522 0.36
523 0.42
524 0.42
525 0.38
526 0.4
527 0.4
528 0.39
529 0.42
530 0.42
531 0.36
532 0.39
533 0.43
534 0.4
535 0.4
536 0.42
537 0.39
538 0.42
539 0.4
540 0.4
541 0.4
542 0.46
543 0.53
544 0.55
545 0.52
546 0.57
547 0.65
548 0.7
549 0.69
550 0.69
551 0.66
552 0.69
553 0.75
554 0.75
555 0.75
556 0.71
557 0.72
558 0.74
559 0.77
560 0.73
561 0.71
562 0.71
563 0.67
564 0.67
565 0.64
566 0.59
567 0.57
568 0.6
569 0.63
570 0.6
571 0.61
572 0.58
573 0.63
574 0.67
575 0.66
576 0.64
577 0.64
578 0.67
579 0.7
580 0.77
581 0.77
582 0.75
583 0.75
584 0.74
585 0.68
586 0.68
587 0.69
588 0.65
589 0.64
590 0.6
591 0.64
592 0.66
593 0.67
594 0.65
595 0.65
596 0.67
597 0.71
598 0.77
599 0.77
600 0.75
601 0.75
602 0.74
603 0.68
604 0.68
605 0.69
606 0.65
607 0.65
608 0.65
609 0.69
610 0.71
611 0.75
612 0.75
613 0.75
614 0.79
615 0.81
616 0.85
617 0.87
618 0.87
619 0.89
620 0.9
621 0.89
622 0.9
623 0.88
624 0.86
625 0.87
626 0.87
627 0.89
628 0.87
629 0.87
630 0.86
631 0.84
632 0.86
633 0.86
634 0.86
635 0.83
636 0.83
637 0.82
638 0.82
639 0.84
640 0.84
641 0.81
642 0.79
643 0.75
644 0.7
645 0.65
646 0.63
647 0.6
648 0.57
649 0.58
650 0.59
651 0.63
652 0.67
653 0.7
654 0.65
655 0.67
656 0.66
657 0.65
658 0.64
659 0.66
660 0.66
661 0.62
662 0.6
663 0.51
664 0.44
665 0.37
666 0.29
667 0.19
668 0.12
669 0.09
670 0.09
671 0.1
672 0.1
673 0.1
674 0.11
675 0.12
676 0.13
677 0.19