FuNGI

A0A0A1TD60

Protein Details

Accession

A0A0A1TD60

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
47-79	LRRGRRGVDRSASRRRKRTWKKLMWVKQSYPDN	Hydrophilic

NLS Segment(s)

Position	Sequence
48-68	RRGRRGVDRSASRRRKRTWKK

Subcellular Location(s)

plas 23, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR009450 Plno_GlcNAc_GPI2
Gene Ontology	GO:0016020 C:membrane GO:0016757 F:glycosyltransferase activity GO:0006506 P:GPI anchor biosynthetic process
Pfam	View protein in Pfam PF06432 GPI2

Amino Acid Sequences

MPSPTDEDTPFPNLNHAATLRSHLSPSDAHISPPRRPYDADGGAEMLRRGRRGVDRSASRRRKRTWKKLMWVKQSYPDNYTDQATFLENLQRNPRLKPYDFWPLIADSTVILQHVCSVIIFIVCFVAIFQERVSPVSVVSWSSVGTFLGWILWERWVSEEHAPSGDDEQGSSNNNILTANNSANVVGAAGAARNDSVRRRARANSLRKPMQSGPPESTLAVPSLPIVHSAANSAASSSTNLPAAVAAAEAAAAAAAKITTSTKQREPSPRSGMDTVPEYPDILPNDENRTHQRLGTIKSAMLIYSTLLGLSPILKSLTRSTSSDSIWAMSFWLLAINIFFFDYSGGVGAKFPASLSTNAALMASTVLASRLPSTKQVFVLTLFSIEVFGLFPVFRRHVRHRSWQYHALLTALLVLGAGFGMGMIMSDARAARWPWKGGIVGMVIGVLLACIAVGGSGWWLIGLQKYKNEIRGPWDPARPIIMSRPRWD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.27
2	0.29
3	0.26
4	0.23
5	0.21
6	0.26
7	0.25
8	0.25
9	0.25
10	0.21
11	0.23
12	0.21
13	0.25
14	0.28
15	0.24
16	0.26
17	0.33
18	0.38
19	0.42
20	0.49
21	0.48
22	0.44
23	0.46
24	0.49
25	0.51
26	0.52
27	0.47
28	0.4
29	0.39
30	0.37
31	0.36
32	0.3
33	0.25
34	0.21
35	0.2
36	0.2
37	0.24
38	0.32
39	0.36
40	0.44
41	0.48
42	0.56
43	0.63
44	0.74
45	0.78
46	0.79
47	0.83
48	0.84
49	0.85
50	0.87
51	0.89
52	0.89
53	0.89
54	0.91
55	0.92
56	0.94
57	0.93
58	0.9
59	0.83
60	0.8
61	0.78
62	0.7
63	0.63
64	0.56
65	0.49
66	0.42
67	0.41
68	0.32
69	0.25
70	0.22
71	0.21
72	0.17
73	0.16
74	0.22
75	0.22
76	0.25
77	0.32
78	0.37
79	0.38
80	0.41
81	0.48
82	0.47
83	0.47
84	0.47
85	0.45
86	0.49
87	0.48
88	0.46
89	0.39
90	0.33
91	0.31
92	0.28
93	0.22
94	0.11
95	0.12
96	0.11
97	0.09
98	0.07
99	0.06
100	0.07
101	0.07
102	0.07
103	0.06
104	0.06
105	0.06
106	0.07
107	0.06
108	0.05
109	0.05
110	0.05
111	0.05
112	0.04
113	0.06
114	0.07
115	0.07
116	0.07
117	0.1
118	0.11
119	0.12
120	0.14
121	0.11
122	0.11
123	0.11
124	0.12
125	0.1
126	0.1
127	0.09
128	0.08
129	0.09
130	0.09
131	0.07
132	0.07
133	0.06
134	0.05
135	0.05
136	0.05
137	0.06
138	0.06
139	0.08
140	0.08
141	0.08
142	0.1
143	0.11
144	0.14
145	0.17
146	0.18
147	0.17
148	0.17
149	0.17
150	0.17
151	0.17
152	0.16
153	0.12
154	0.1
155	0.1
156	0.11
157	0.13
158	0.12
159	0.12
160	0.1
161	0.11
162	0.11
163	0.1
164	0.1
165	0.11
166	0.11
167	0.1
168	0.1
169	0.1
170	0.1
171	0.09
172	0.07
173	0.04
174	0.04
175	0.03
176	0.03
177	0.04
178	0.04
179	0.04
180	0.04
181	0.06
182	0.09
183	0.17
184	0.23
185	0.25
186	0.29
187	0.32
188	0.42
189	0.5
190	0.58
191	0.59
192	0.62
193	0.65
194	0.62
195	0.64
196	0.57
197	0.55
198	0.5
199	0.44
200	0.38
201	0.35
202	0.36
203	0.31
204	0.28
205	0.21
206	0.16
207	0.13
208	0.09
209	0.07
210	0.07
211	0.06
212	0.06
213	0.06
214	0.06
215	0.06
216	0.07
217	0.07
218	0.07
219	0.07
220	0.06
221	0.06
222	0.06
223	0.07
224	0.07
225	0.08
226	0.07
227	0.07
228	0.07
229	0.06
230	0.06
231	0.05
232	0.04
233	0.03
234	0.03
235	0.03
236	0.02
237	0.02
238	0.02
239	0.02
240	0.02
241	0.02
242	0.02
243	0.02
244	0.02
245	0.03
246	0.06
247	0.11
248	0.15
249	0.19
250	0.23
251	0.3
252	0.39
253	0.45
254	0.51
255	0.54
256	0.52
257	0.51
258	0.49
259	0.43
260	0.35
261	0.31
262	0.24
263	0.19
264	0.17
265	0.14
266	0.12
267	0.15
268	0.14
269	0.14
270	0.14
271	0.14
272	0.19
273	0.2
274	0.22
275	0.24
276	0.28
277	0.27
278	0.26
279	0.29
280	0.28
281	0.31
282	0.33
283	0.29
284	0.24
285	0.24
286	0.24
287	0.19
288	0.15
289	0.11
290	0.07
291	0.06
292	0.06
293	0.05
294	0.05
295	0.05
296	0.04
297	0.05
298	0.05
299	0.05
300	0.06
301	0.06
302	0.08
303	0.12
304	0.16
305	0.18
306	0.19
307	0.22
308	0.25
309	0.25
310	0.26
311	0.23
312	0.2
313	0.18
314	0.16
315	0.13
316	0.09
317	0.09
318	0.06
319	0.06
320	0.05
321	0.05
322	0.05
323	0.04
324	0.05
325	0.05
326	0.05
327	0.04
328	0.04
329	0.05
330	0.05
331	0.05
332	0.05
333	0.05
334	0.06
335	0.06
336	0.06
337	0.06
338	0.06
339	0.08
340	0.1
341	0.11
342	0.13
343	0.14
344	0.14
345	0.14
346	0.14
347	0.11
348	0.09
349	0.08
350	0.05
351	0.04
352	0.04
353	0.04
354	0.05
355	0.05
356	0.07
357	0.1
358	0.11
359	0.17
360	0.21
361	0.24
362	0.25
363	0.27
364	0.26
365	0.25
366	0.26
367	0.2
368	0.17
369	0.14
370	0.12
371	0.11
372	0.09
373	0.08
374	0.06
375	0.05
376	0.06
377	0.05
378	0.07
379	0.11
380	0.15
381	0.19
382	0.26
383	0.35
384	0.44
385	0.51
386	0.6
387	0.66
388	0.71
389	0.75
390	0.76
391	0.71
392	0.65
393	0.59
394	0.48
395	0.38
396	0.29
397	0.23
398	0.14
399	0.1
400	0.06
401	0.05
402	0.04
403	0.04
404	0.04
405	0.02
406	0.02
407	0.02
408	0.02
409	0.02
410	0.02
411	0.03
412	0.03
413	0.05
414	0.05
415	0.06
416	0.1
417	0.12
418	0.18
419	0.23
420	0.26
421	0.26
422	0.3
423	0.3
424	0.28
425	0.3
426	0.24
427	0.19
428	0.16
429	0.14
430	0.1
431	0.09
432	0.08
433	0.04
434	0.03
435	0.02
436	0.02
437	0.02
438	0.02
439	0.02
440	0.02
441	0.02
442	0.03
443	0.04
444	0.04
445	0.04
446	0.04
447	0.06
448	0.11
449	0.16
450	0.19
451	0.24
452	0.31
453	0.35
454	0.42
455	0.46
456	0.44
457	0.46
458	0.51
459	0.54
460	0.55
461	0.58
462	0.53
463	0.51
464	0.52
465	0.46
466	0.41
467	0.43
468	0.45

A0A0A1TD60

3D AlphaFold-predicted Structure Viewer