Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1TBY8

Protein Details
Accession A0A0A1TBY8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
106-125DPETIKPKPKGKWHERFGATBasic
NLS Segment(s)
PositionSequence
113-116KPKG
Subcellular Location(s) cyto 10.5, cyto_nucl 9, nucl 6.5, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019128  Dcc1  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0006260  P:DNA replication  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09724  Dcc1  
Amino Acid Sequences MASQNDAGITVKANPSQDGFRLIELPPELETLLTSPDAPVLTFESAGNDTLTVLKTPGKNYILRQKNTSNGLWLLQPHNDPESMQTGLSTIATIHETVELELMKDDPETIKPKPKGKWHERFGATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.22
4 0.22
5 0.24
6 0.22
7 0.21
8 0.22
9 0.21
10 0.22
11 0.2
12 0.2
13 0.15
14 0.15
15 0.14
16 0.11
17 0.11
18 0.08
19 0.09
20 0.08
21 0.07
22 0.06
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.1
30 0.1
31 0.1
32 0.11
33 0.11
34 0.1
35 0.08
36 0.08
37 0.08
38 0.08
39 0.07
40 0.07
41 0.09
42 0.11
43 0.12
44 0.17
45 0.18
46 0.2
47 0.23
48 0.33
49 0.38
50 0.37
51 0.41
52 0.38
53 0.4
54 0.42
55 0.39
56 0.31
57 0.24
58 0.23
59 0.2
60 0.19
61 0.16
62 0.14
63 0.15
64 0.14
65 0.14
66 0.14
67 0.13
68 0.13
69 0.14
70 0.13
71 0.12
72 0.11
73 0.1
74 0.1
75 0.1
76 0.08
77 0.05
78 0.05
79 0.06
80 0.07
81 0.06
82 0.07
83 0.08
84 0.08
85 0.1
86 0.09
87 0.08
88 0.09
89 0.09
90 0.08
91 0.08
92 0.08
93 0.08
94 0.13
95 0.18
96 0.22
97 0.31
98 0.38
99 0.45
100 0.52
101 0.61
102 0.67
103 0.73
104 0.8
105 0.77
106 0.8