Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1T5H4

Protein Details
Accession A0A0A1T5H4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-27TIGQGTKLGHHKNRRHPVAKRDQPASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTIGQGTKLGHHKNRRHPVAKRDQPASNEDDSDSSYYSELSELQQEEMFTPPEKALRTYCGLETNNVFIFVIDDDGSPKVYSNQKDALSKGVLEQYFDPEAYFDISVDQQCQEYQQAEKRPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.82
5 0.84
6 0.86
7 0.86
8 0.82
9 0.76
10 0.71
11 0.65
12 0.61
13 0.56
14 0.46
15 0.38
16 0.31
17 0.26
18 0.23
19 0.21
20 0.18
21 0.13
22 0.11
23 0.1
24 0.1
25 0.09
26 0.08
27 0.08
28 0.1
29 0.1
30 0.11
31 0.11
32 0.11
33 0.12
34 0.12
35 0.13
36 0.1
37 0.1
38 0.1
39 0.12
40 0.12
41 0.13
42 0.13
43 0.15
44 0.17
45 0.17
46 0.18
47 0.2
48 0.2
49 0.19
50 0.19
51 0.18
52 0.16
53 0.15
54 0.14
55 0.08
56 0.09
57 0.07
58 0.08
59 0.06
60 0.05
61 0.06
62 0.07
63 0.08
64 0.07
65 0.07
66 0.11
67 0.16
68 0.18
69 0.21
70 0.26
71 0.28
72 0.31
73 0.31
74 0.31
75 0.27
76 0.25
77 0.23
78 0.23
79 0.2
80 0.19
81 0.19
82 0.19
83 0.2
84 0.2
85 0.18
86 0.12
87 0.13
88 0.14
89 0.13
90 0.09
91 0.09
92 0.12
93 0.12
94 0.14
95 0.14
96 0.13
97 0.13
98 0.15
99 0.16
100 0.16
101 0.21
102 0.28
103 0.35