Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TTV5

Protein Details
Accession A7TTV5   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
136-156LLEYLKKKYGRKCVKSTMPIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035179  DUF5314  
KEGG vpo:Kpol_151p1  -  
Pfam View protein in Pfam  
PF17241  Retrotran_gag_4  
Amino Acid Sequences MSHPDQQSNNTHLFQSQEIGAVLVSNLRKQVMSPANATDLIPIELLGVQNYDMWYHYFMQVVGEASHIWSEYVETGDIQSVRIEYGLPDIQIKSMKIILDTNLVSLIKKNVSKDIEKKIRNSFLMTKRSGPTGLLLLEYLKKKYGRKCVKSTMPIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.19
4 0.16
5 0.14
6 0.14
7 0.12
8 0.1
9 0.09
10 0.1
11 0.11
12 0.1
13 0.11
14 0.12
15 0.12
16 0.12
17 0.22
18 0.24
19 0.26
20 0.27
21 0.28
22 0.29
23 0.3
24 0.29
25 0.21
26 0.16
27 0.14
28 0.12
29 0.1
30 0.08
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.06
40 0.07
41 0.09
42 0.1
43 0.11
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.07
73 0.07
74 0.08
75 0.09
76 0.09
77 0.1
78 0.12
79 0.12
80 0.1
81 0.11
82 0.11
83 0.11
84 0.12
85 0.11
86 0.13
87 0.13
88 0.12
89 0.12
90 0.12
91 0.11
92 0.12
93 0.13
94 0.14
95 0.16
96 0.17
97 0.22
98 0.26
99 0.32
100 0.38
101 0.46
102 0.52
103 0.53
104 0.58
105 0.59
106 0.62
107 0.57
108 0.56
109 0.54
110 0.53
111 0.57
112 0.54
113 0.51
114 0.46
115 0.47
116 0.43
117 0.34
118 0.27
119 0.23
120 0.21
121 0.16
122 0.15
123 0.14
124 0.19
125 0.21
126 0.2
127 0.22
128 0.27
129 0.33
130 0.41
131 0.5
132 0.56
133 0.63
134 0.7
135 0.76
136 0.81