Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P36532

Protein Details
Accession P36532   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-105EGQALLKRRKNIRKANRQRIKQNNFLSQLHydrophilic
NLS Segment(s)
PositionSequence
83-94KRRKNIRKANRQ
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG sce:YBR268W  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLARSLGYRLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWSVLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.29
5 0.35
6 0.4
7 0.4
8 0.4
9 0.36
10 0.35
11 0.37
12 0.35
13 0.32
14 0.28
15 0.28
16 0.25
17 0.24
18 0.23
19 0.2
20 0.17
21 0.13
22 0.11
23 0.15
24 0.18
25 0.17
26 0.18
27 0.18
28 0.18
29 0.16
30 0.17
31 0.12
32 0.11
33 0.11
34 0.12
35 0.16
36 0.16
37 0.16
38 0.18
39 0.18
40 0.17
41 0.18
42 0.16
43 0.11
44 0.11
45 0.11
46 0.06
47 0.07
48 0.1
49 0.09
50 0.1
51 0.09
52 0.1
53 0.09
54 0.09
55 0.09
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.07
67 0.15
68 0.24
69 0.28
70 0.35
71 0.45
72 0.54
73 0.65
74 0.73
75 0.76
76 0.79
77 0.87
78 0.91
79 0.91
80 0.91
81 0.92
82 0.92
83 0.89
84 0.87
85 0.84