Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1T813

Protein Details
Accession A0A0A1T813    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRMRLQAVDNVHydrophilic
81-103FDRNAKRYRKGIHKVPKWTRVSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSKFQKRRHRMRLQAVDNVVATLDAALAKKGQTLEALERWKEEMPTEAEMLPRDKYTVFDRNAKRYRKGIHKVPKWTRVSQRINPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.83
16 0.87
17 0.89
18 0.89
19 0.87
20 0.88
21 0.88
22 0.81
23 0.77
24 0.68
25 0.58
26 0.48
27 0.38
28 0.27
29 0.16
30 0.12
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.06
41 0.06
42 0.08
43 0.1
44 0.15
45 0.17
46 0.16
47 0.16
48 0.18
49 0.18
50 0.16
51 0.14
52 0.13
53 0.13
54 0.15
55 0.16
56 0.15
57 0.15
58 0.16
59 0.17
60 0.15
61 0.13
62 0.12
63 0.11
64 0.13
65 0.18
66 0.25
67 0.26
68 0.35
69 0.4
70 0.49
71 0.58
72 0.61
73 0.6
74 0.59
75 0.64
76 0.66
77 0.69
78 0.69
79 0.72
80 0.75
81 0.81
82 0.83
83 0.85
84 0.8
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79