Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1T5J5

Protein Details
Accession A0A0A1T5J5   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-33GARLNRGRPRARNTLCRDRWRQDLRRSKNATLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000209  Peptidase_S8/S53_dom  
IPR036852  Peptidase_S8/S53_dom_sf  
IPR023828  Peptidase_S8_Ser-AS  
Gene Ontology GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00082  Peptidase_S8  
PROSITE View protein in PROSITE  
PS51892  SUBTILASE  
PS00138  SUBTILASE_SER  
Amino Acid Sequences MGARLNRGRPRARNTLCRDRWRQDLRRSKNATLFAMKVLNDKGRGHVDSVIAAIDEVAADAPKRHCPRGVAMSVSLGFAGSQQSLQQATANLVKKGFFFAASAGNKNKDAEGHSPAGEPLACTVGAMDEDDKMASFSNFGPLVDPQAPGVDVVSAKSGGGSVSMSGTSMACPHVAGQAAVLMSSESIKGDLVCDRLKALALKGVVTGVPDDTTSDLLFNGNPEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.81
4 0.82
5 0.83
6 0.77
7 0.8
8 0.8
9 0.8
10 0.79
11 0.81
12 0.8
13 0.82
14 0.84
15 0.79
16 0.75
17 0.71
18 0.65
19 0.59
20 0.51
21 0.43
22 0.39
23 0.34
24 0.3
25 0.29
26 0.28
27 0.27
28 0.26
29 0.27
30 0.29
31 0.3
32 0.28
33 0.27
34 0.24
35 0.21
36 0.2
37 0.16
38 0.11
39 0.1
40 0.07
41 0.05
42 0.04
43 0.03
44 0.03
45 0.03
46 0.04
47 0.07
48 0.09
49 0.17
50 0.21
51 0.23
52 0.25
53 0.28
54 0.33
55 0.38
56 0.39
57 0.33
58 0.3
59 0.3
60 0.28
61 0.25
62 0.19
63 0.11
64 0.08
65 0.06
66 0.07
67 0.05
68 0.05
69 0.05
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.1
76 0.15
77 0.17
78 0.16
79 0.16
80 0.17
81 0.16
82 0.17
83 0.15
84 0.1
85 0.08
86 0.08
87 0.15
88 0.16
89 0.18
90 0.18
91 0.19
92 0.2
93 0.2
94 0.19
95 0.13
96 0.15
97 0.15
98 0.18
99 0.18
100 0.17
101 0.17
102 0.17
103 0.16
104 0.13
105 0.1
106 0.06
107 0.06
108 0.05
109 0.05
110 0.05
111 0.04
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.04
122 0.05
123 0.05
124 0.09
125 0.09
126 0.09
127 0.1
128 0.1
129 0.14
130 0.14
131 0.14
132 0.11
133 0.11
134 0.11
135 0.1
136 0.1
137 0.07
138 0.06
139 0.06
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.04
149 0.05
150 0.05
151 0.06
152 0.06
153 0.06
154 0.06
155 0.07
156 0.07
157 0.06
158 0.07
159 0.07
160 0.09
161 0.09
162 0.09
163 0.08
164 0.09
165 0.09
166 0.09
167 0.08
168 0.06
169 0.05
170 0.06
171 0.06
172 0.05
173 0.05
174 0.06
175 0.06
176 0.08
177 0.1
178 0.13
179 0.14
180 0.15
181 0.15
182 0.15
183 0.18
184 0.18
185 0.17
186 0.18
187 0.17
188 0.17
189 0.16
190 0.17
191 0.15
192 0.14
193 0.13
194 0.09
195 0.09
196 0.09
197 0.1
198 0.11
199 0.12
200 0.11
201 0.11
202 0.1
203 0.11
204 0.11
205 0.11