Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1SKV7

Protein Details
Accession A0A0A1SKV7    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
147-174KKDRLEDTKQSLRKKRKRKGEDDEDGDTBasic
NLS Segment(s)
PositionSequence
9-65SKGKGSSSKSGAGGKSGSGGRSASAGVSKPSKPKGPSKAQQVKEKNILAMFKKPKKK
87-95KPKGKKKGK
142-166KKEQEKKDRLEDTKQSLRKKRKRKG
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MAPSNSKSSKGKGSSSKSGAGGKSGSGGRSASAGVSKPSKPKGPSKAQQVKEKNILAMFKKPKKKTYTDAELGIPTLNMITPVGVVKPKGKKKGKIFVDDKESMSTILSIVQAEKDGQIESKMIKARQMEEIREARRVETEKKEQEKKDRLEDTKQSLRKKRKRKGEDDEDGDTVKSYASTGSKATKAKSSKKRVSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.62
4 0.56
5 0.57
6 0.49
7 0.43
8 0.35
9 0.26
10 0.27
11 0.24
12 0.21
13 0.17
14 0.17
15 0.14
16 0.14
17 0.14
18 0.11
19 0.11
20 0.12
21 0.14
22 0.18
23 0.21
24 0.26
25 0.31
26 0.37
27 0.4
28 0.48
29 0.54
30 0.6
31 0.64
32 0.69
33 0.74
34 0.73
35 0.79
36 0.77
37 0.74
38 0.71
39 0.65
40 0.56
41 0.48
42 0.46
43 0.38
44 0.4
45 0.43
46 0.44
47 0.52
48 0.55
49 0.6
50 0.63
51 0.66
52 0.64
53 0.64
54 0.65
55 0.59
56 0.56
57 0.5
58 0.44
59 0.38
60 0.31
61 0.21
62 0.12
63 0.08
64 0.06
65 0.04
66 0.04
67 0.03
68 0.04
69 0.04
70 0.05
71 0.06
72 0.07
73 0.12
74 0.21
75 0.27
76 0.37
77 0.43
78 0.5
79 0.57
80 0.66
81 0.66
82 0.68
83 0.65
84 0.6
85 0.61
86 0.55
87 0.47
88 0.39
89 0.33
90 0.24
91 0.2
92 0.15
93 0.08
94 0.07
95 0.06
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.11
109 0.14
110 0.14
111 0.17
112 0.19
113 0.2
114 0.28
115 0.31
116 0.29
117 0.32
118 0.38
119 0.36
120 0.4
121 0.38
122 0.3
123 0.31
124 0.33
125 0.33
126 0.34
127 0.42
128 0.46
129 0.54
130 0.62
131 0.63
132 0.69
133 0.73
134 0.7
135 0.7
136 0.7
137 0.66
138 0.66
139 0.67
140 0.64
141 0.65
142 0.66
143 0.66
144 0.67
145 0.74
146 0.76
147 0.81
148 0.82
149 0.84
150 0.88
151 0.89
152 0.9
153 0.89
154 0.89
155 0.84
156 0.79
157 0.7
158 0.6
159 0.5
160 0.39
161 0.29
162 0.19
163 0.13
164 0.08
165 0.1
166 0.11
167 0.12
168 0.15
169 0.2
170 0.26
171 0.3
172 0.32
173 0.37
174 0.44
175 0.53
176 0.6
177 0.66
178 0.7