Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TNM3

Protein Details
Accession A0A0A1TNM3   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-183SEEETRAQKRKNKKKSHNKKKKESRDSASNTSHydrophilic
NLS Segment(s)
PositionSequence
158-175AQKRKNKKKSHNKKKKES
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR039690  SNRNP25  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF02179  BAG  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS51035  BAG  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MSRYGWSLHREGSSPYTSMRGGVPTVTEDDFSYITSQDLDDVRHSRRTHRDESDDVLIIKNQGVTYPAHFPPYAIGDGKLLVKDVKHRIGLLMGLSDRRTHRIKLLYKGRQLKDPEATVREYGIKNKSELMAVVPEEERLAPADLDDTIIVSEEETRAQKRKNKKKSHNKKKKESRDSASNTSTISSPRSPQPSPAQPSGPFEVLDSLRNKYLVEWLPLCEEYLAAPPADPKKREEEHRKLSESIMAQIILKLDAVETGGNEEIRNKRRAIVKEVEATLRQLDSAKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.27
4 0.25
5 0.25
6 0.22
7 0.19
8 0.17
9 0.16
10 0.16
11 0.15
12 0.18
13 0.17
14 0.16
15 0.14
16 0.16
17 0.15
18 0.15
19 0.14
20 0.11
21 0.11
22 0.11
23 0.1
24 0.11
25 0.12
26 0.13
27 0.17
28 0.21
29 0.24
30 0.31
31 0.32
32 0.37
33 0.47
34 0.52
35 0.56
36 0.59
37 0.62
38 0.58
39 0.62
40 0.58
41 0.49
42 0.43
43 0.35
44 0.28
45 0.23
46 0.2
47 0.16
48 0.11
49 0.1
50 0.11
51 0.11
52 0.13
53 0.18
54 0.18
55 0.2
56 0.2
57 0.2
58 0.2
59 0.22
60 0.22
61 0.16
62 0.16
63 0.14
64 0.15
65 0.16
66 0.14
67 0.12
68 0.1
69 0.1
70 0.17
71 0.22
72 0.25
73 0.25
74 0.25
75 0.25
76 0.25
77 0.25
78 0.18
79 0.14
80 0.11
81 0.11
82 0.11
83 0.14
84 0.14
85 0.18
86 0.2
87 0.2
88 0.25
89 0.32
90 0.37
91 0.43
92 0.53
93 0.55
94 0.61
95 0.69
96 0.65
97 0.63
98 0.61
99 0.56
100 0.5
101 0.45
102 0.4
103 0.34
104 0.34
105 0.27
106 0.25
107 0.24
108 0.21
109 0.23
110 0.24
111 0.22
112 0.21
113 0.22
114 0.22
115 0.18
116 0.17
117 0.14
118 0.11
119 0.09
120 0.1
121 0.09
122 0.08
123 0.08
124 0.08
125 0.07
126 0.06
127 0.07
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.03
139 0.04
140 0.04
141 0.06
142 0.07
143 0.09
144 0.13
145 0.18
146 0.25
147 0.35
148 0.46
149 0.55
150 0.65
151 0.74
152 0.82
153 0.89
154 0.94
155 0.94
156 0.94
157 0.94
158 0.95
159 0.95
160 0.94
161 0.91
162 0.86
163 0.85
164 0.81
165 0.76
166 0.67
167 0.56
168 0.46
169 0.38
170 0.32
171 0.23
172 0.2
173 0.15
174 0.16
175 0.21
176 0.26
177 0.26
178 0.3
179 0.37
180 0.42
181 0.46
182 0.47
183 0.46
184 0.41
185 0.45
186 0.43
187 0.36
188 0.27
189 0.22
190 0.23
191 0.19
192 0.22
193 0.2
194 0.19
195 0.19
196 0.19
197 0.19
198 0.16
199 0.22
200 0.21
201 0.23
202 0.22
203 0.23
204 0.26
205 0.26
206 0.25
207 0.18
208 0.15
209 0.11
210 0.14
211 0.13
212 0.1
213 0.1
214 0.14
215 0.23
216 0.29
217 0.29
218 0.29
219 0.37
220 0.43
221 0.53
222 0.59
223 0.62
224 0.66
225 0.72
226 0.73
227 0.66
228 0.62
229 0.57
230 0.47
231 0.4
232 0.31
233 0.24
234 0.2
235 0.19
236 0.18
237 0.13
238 0.12
239 0.09
240 0.07
241 0.07
242 0.07
243 0.07
244 0.06
245 0.08
246 0.1
247 0.11
248 0.11
249 0.17
250 0.25
251 0.31
252 0.34
253 0.33
254 0.37
255 0.45
256 0.5
257 0.52
258 0.52
259 0.52
260 0.56
261 0.58
262 0.57
263 0.5
264 0.46
265 0.4
266 0.32
267 0.26
268 0.2