Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q03435

Protein Details
Accession Q03435    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-97ELLTKPFRKSKTKRHKVKERDPNMPKRPBasic
NLS Segment(s)
PositionSequence
75-94PFRKSKTKRHKVKERDPNMP
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0005634  C:nucleus  
GO:0045027  F:DNA end binding  
GO:0000404  F:heteroduplex DNA loop binding  
GO:0006338  P:chromatin remodeling  
GO:0006281  P:DNA repair  
GO:0006302  P:double-strand break repair  
GO:0006355  P:regulation of DNA-templated transcription  
GO:0000722  P:telomere maintenance via recombination  
KEGG sce:YDL002C  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd22016  HMG-box_NHP10-like  
Amino Acid Sequences MSVEEKKRRLEELKDQNVVLGLAIQRSRLSVKRLKLEYGVLLERLESRIELDPELNCEDPLPTLASFKQELLTKPFRKSKTKRHKVKERDPNMPKRPTNAYLLYCEMNKERIRQNGSLDVTRDLAEGWKNLNEQDRKPYYKLYSEDRERYQMEMEIYNKKISNIDADDDKEENEQKIKNNEEGSSTKVADSKGGEDGSLVSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.54
4 0.48
5 0.4
6 0.29
7 0.21
8 0.13
9 0.13
10 0.13
11 0.14
12 0.13
13 0.15
14 0.19
15 0.2
16 0.27
17 0.3
18 0.36
19 0.44
20 0.47
21 0.48
22 0.46
23 0.44
24 0.4
25 0.38
26 0.33
27 0.24
28 0.22
29 0.2
30 0.18
31 0.17
32 0.15
33 0.1
34 0.11
35 0.14
36 0.15
37 0.15
38 0.16
39 0.15
40 0.18
41 0.21
42 0.18
43 0.14
44 0.13
45 0.13
46 0.12
47 0.12
48 0.11
49 0.08
50 0.1
51 0.1
52 0.13
53 0.13
54 0.13
55 0.15
56 0.16
57 0.18
58 0.23
59 0.32
60 0.33
61 0.38
62 0.45
63 0.48
64 0.55
65 0.61
66 0.66
67 0.68
68 0.75
69 0.79
70 0.82
71 0.88
72 0.88
73 0.91
74 0.9
75 0.85
76 0.85
77 0.83
78 0.82
79 0.8
80 0.77
81 0.68
82 0.6
83 0.59
84 0.51
85 0.47
86 0.41
87 0.34
88 0.29
89 0.3
90 0.26
91 0.21
92 0.2
93 0.16
94 0.18
95 0.18
96 0.19
97 0.22
98 0.27
99 0.31
100 0.32
101 0.33
102 0.35
103 0.36
104 0.34
105 0.31
106 0.26
107 0.22
108 0.21
109 0.18
110 0.11
111 0.11
112 0.1
113 0.1
114 0.1
115 0.11
116 0.11
117 0.13
118 0.2
119 0.23
120 0.23
121 0.32
122 0.37
123 0.39
124 0.4
125 0.44
126 0.4
127 0.43
128 0.45
129 0.43
130 0.45
131 0.49
132 0.53
133 0.5
134 0.52
135 0.47
136 0.45
137 0.39
138 0.32
139 0.27
140 0.25
141 0.25
142 0.27
143 0.27
144 0.29
145 0.28
146 0.26
147 0.25
148 0.22
149 0.26
150 0.22
151 0.23
152 0.23
153 0.25
154 0.27
155 0.26
156 0.26
157 0.23
158 0.23
159 0.22
160 0.23
161 0.24
162 0.27
163 0.33
164 0.37
165 0.38
166 0.39
167 0.38
168 0.39
169 0.39
170 0.37
171 0.35
172 0.32
173 0.28
174 0.28
175 0.27
176 0.25
177 0.25
178 0.23
179 0.23
180 0.22
181 0.21
182 0.18
183 0.19