Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q02260

Protein Details
Accession Q02260    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
124-145NDPSKKRRRDFGAPANKRPRRGBasic
NLS Segment(s)
PositionSequence
127-146SKKRRRDFGAPANKRPRRGL
Subcellular Location(s) nucl 23, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0071013  C:catalytic step 2 spliceosome  
GO:0000243  C:commitment complex  
GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0034715  C:pICln-Sm protein complex  
GO:0071011  C:precatalytic spliceosome  
GO:0030532  C:small nuclear ribonucleoprotein complex  
GO:0034719  C:SMN-Sm protein complex  
GO:0005681  C:spliceosomal complex  
GO:0097526  C:spliceosomal tri-snRNP complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0005687  C:U4 snRNP  
GO:0071001  C:U4/U6 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0003729  F:mRNA binding  
GO:0003723  F:RNA binding  
GO:0036261  P:7-methylguanosine cap hypermethylation  
GO:0000395  P:mRNA 5'-splice site recognition  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0000245  P:spliceosomal complex assembly  
GO:0000387  P:spliceosomal snRNP assembly  
GO:1903241  P:U2-type prespliceosome assembly  
KEGG sce:YGR074W  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMASLYLTGGQQPTASDNIASLQYINIRGNTIRQIILPDSLNLDSLLVDQKQLNSLRRSGQIANDPSKKRRRDFGAPANKRPRRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.51
4 0.45
5 0.37
6 0.31
7 0.3
8 0.27
9 0.18
10 0.12
11 0.11
12 0.11
13 0.13
14 0.13
15 0.13
16 0.14
17 0.14
18 0.16
19 0.16
20 0.15
21 0.12
22 0.12
23 0.11
24 0.1
25 0.1
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.09
32 0.1
33 0.15
34 0.17
35 0.22
36 0.25
37 0.3
38 0.33
39 0.35
40 0.4
41 0.37
42 0.43
43 0.38
44 0.37
45 0.32
46 0.28
47 0.25
48 0.19
49 0.16
50 0.06
51 0.05
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.06
61 0.07
62 0.07
63 0.06
64 0.06
65 0.07
66 0.07
67 0.07
68 0.05
69 0.05
70 0.06
71 0.08
72 0.09
73 0.08
74 0.09
75 0.09
76 0.11
77 0.13
78 0.14
79 0.12
80 0.12
81 0.14
82 0.14
83 0.16
84 0.15
85 0.13
86 0.13
87 0.13
88 0.13
89 0.11
90 0.1
91 0.08
92 0.08
93 0.11
94 0.08
95 0.1
96 0.1
97 0.1
98 0.16
99 0.2
100 0.25
101 0.25
102 0.28
103 0.31
104 0.33
105 0.37
106 0.33
107 0.34
108 0.37
109 0.41
110 0.47
111 0.51
112 0.53
113 0.58
114 0.65
115 0.68
116 0.64
117 0.67
118 0.67
119 0.68
120 0.74
121 0.76
122 0.78
123 0.79
124 0.84
125 0.87
126 0.84