Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1SNP4

Protein Details
Accession A0A0A1SNP4   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
190-213SQTPPPPKPKPSPQPKSPRPDAKGHydrophilic
361-385DSYSYRPYDKPKQPQRKKSNGSLASHydrophilic
NLS Segment(s)
PositionSequence
195-280PPKPKPSPQPKSPRPDAKGSWEKARDEMRKKEEERKAKAAEQKRREEISKRLAELRAKEAKERLQREKDKEKKEKEIKEAAEKKAA
Subcellular Location(s) plas 15, nucl 4.5, mito 4, cyto_nucl 3.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037651  Swc3  
Gene Ontology GO:0016020  C:membrane  
GO:0000812  C:Swr1 complex  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
Amino Acid Sequences MNAPPPPPPPHGEMPRSSSGLPPGKYDIFVIPEHSAGSGFLYLPSLKPNINSFVAGFASALILVVLFQSITPAFRVWWDSFHGLGNMAMLMLLVGVGFGAWALGRTQNDAGNNNSGSKKREPPNTNGNAGTQPGGQGGFENGHSRGTSNSSAPPPHSPPPPPPPPPNGGGPGPGPSTWDSGSPPNYQYQSQTPPPPKPKPSPQPKSPRPDAKGSWEKARDEMRKKEEERKAKAAEQKRREEISKRLAELRAKEAKERLQREKDKEKKEKEIKEAAEKKAAAAAAAATAKAAASTPSTPAAPPPRAQSSYAYSGVGEKMNMWPNGKPPTPPTHTNTTPKSPASPTKRPPAPTARTYLSTDEDSYSYRPYDKPKQPQRKKSNGSLASDVSWANSHTTARTSPPPSVRGPYTTKDPDKIVIQAVYMFMNQFAKTPASQLISGVGSVTDGLILRITTEGLFIDDDVRGVPQREWDVKGWTLKLVETGEWKTKGLHLLRATVKDQDGKRYLFVIDETEYWKVGASIQRLRRGTQARQLGVAAMTAAEARTTLDTLGWTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.57
4 0.51
5 0.45
6 0.45
7 0.46
8 0.42
9 0.39
10 0.39
11 0.38
12 0.38
13 0.37
14 0.31
15 0.27
16 0.26
17 0.27
18 0.22
19 0.21
20 0.21
21 0.19
22 0.16
23 0.12
24 0.13
25 0.1
26 0.09
27 0.09
28 0.11
29 0.12
30 0.12
31 0.15
32 0.16
33 0.16
34 0.19
35 0.22
36 0.25
37 0.26
38 0.27
39 0.24
40 0.24
41 0.23
42 0.21
43 0.17
44 0.11
45 0.1
46 0.08
47 0.08
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.05
56 0.06
57 0.07
58 0.08
59 0.09
60 0.09
61 0.12
62 0.17
63 0.16
64 0.18
65 0.23
66 0.24
67 0.24
68 0.25
69 0.24
70 0.19
71 0.18
72 0.16
73 0.11
74 0.08
75 0.07
76 0.05
77 0.04
78 0.03
79 0.03
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.03
89 0.04
90 0.08
91 0.08
92 0.12
93 0.14
94 0.16
95 0.2
96 0.22
97 0.24
98 0.25
99 0.26
100 0.27
101 0.29
102 0.29
103 0.31
104 0.35
105 0.41
106 0.44
107 0.53
108 0.55
109 0.58
110 0.66
111 0.67
112 0.64
113 0.56
114 0.51
115 0.43
116 0.38
117 0.33
118 0.22
119 0.17
120 0.13
121 0.12
122 0.1
123 0.08
124 0.09
125 0.09
126 0.09
127 0.11
128 0.11
129 0.12
130 0.12
131 0.12
132 0.13
133 0.16
134 0.17
135 0.17
136 0.21
137 0.23
138 0.25
139 0.27
140 0.31
141 0.32
142 0.35
143 0.38
144 0.37
145 0.41
146 0.48
147 0.54
148 0.55
149 0.55
150 0.56
151 0.54
152 0.54
153 0.5
154 0.45
155 0.37
156 0.33
157 0.28
158 0.25
159 0.22
160 0.19
161 0.18
162 0.15
163 0.17
164 0.15
165 0.16
166 0.15
167 0.18
168 0.22
169 0.22
170 0.22
171 0.24
172 0.26
173 0.25
174 0.26
175 0.27
176 0.3
177 0.32
178 0.39
179 0.4
180 0.47
181 0.55
182 0.6
183 0.61
184 0.63
185 0.68
186 0.71
187 0.77
188 0.77
189 0.78
190 0.81
191 0.83
192 0.84
193 0.82
194 0.81
195 0.74
196 0.72
197 0.65
198 0.63
199 0.64
200 0.58
201 0.57
202 0.51
203 0.48
204 0.46
205 0.52
206 0.5
207 0.48
208 0.54
209 0.53
210 0.57
211 0.59
212 0.65
213 0.65
214 0.66
215 0.65
216 0.64
217 0.61
218 0.59
219 0.64
220 0.63
221 0.64
222 0.63
223 0.63
224 0.6
225 0.6
226 0.58
227 0.54
228 0.52
229 0.52
230 0.48
231 0.43
232 0.41
233 0.42
234 0.42
235 0.39
236 0.39
237 0.37
238 0.34
239 0.34
240 0.34
241 0.37
242 0.42
243 0.46
244 0.47
245 0.49
246 0.56
247 0.61
248 0.69
249 0.71
250 0.73
251 0.77
252 0.74
253 0.74
254 0.76
255 0.75
256 0.7
257 0.69
258 0.61
259 0.62
260 0.63
261 0.55
262 0.5
263 0.44
264 0.37
265 0.32
266 0.29
267 0.19
268 0.12
269 0.1
270 0.07
271 0.07
272 0.07
273 0.04
274 0.04
275 0.04
276 0.04
277 0.04
278 0.03
279 0.05
280 0.05
281 0.07
282 0.08
283 0.08
284 0.08
285 0.12
286 0.18
287 0.18
288 0.19
289 0.22
290 0.26
291 0.28
292 0.29
293 0.28
294 0.26
295 0.29
296 0.29
297 0.25
298 0.2
299 0.19
300 0.19
301 0.16
302 0.12
303 0.08
304 0.11
305 0.16
306 0.18
307 0.18
308 0.18
309 0.22
310 0.28
311 0.28
312 0.25
313 0.25
314 0.31
315 0.35
316 0.39
317 0.38
318 0.41
319 0.45
320 0.5
321 0.51
322 0.48
323 0.47
324 0.43
325 0.42
326 0.38
327 0.42
328 0.43
329 0.48
330 0.48
331 0.54
332 0.58
333 0.58
334 0.6
335 0.61
336 0.58
337 0.53
338 0.53
339 0.46
340 0.44
341 0.44
342 0.4
343 0.33
344 0.28
345 0.26
346 0.21
347 0.19
348 0.18
349 0.17
350 0.16
351 0.14
352 0.15
353 0.17
354 0.23
355 0.33
356 0.4
357 0.5
358 0.59
359 0.7
360 0.78
361 0.86
362 0.89
363 0.9
364 0.87
365 0.85
366 0.85
367 0.79
368 0.73
369 0.65
370 0.56
371 0.46
372 0.41
373 0.32
374 0.22
375 0.17
376 0.13
377 0.11
378 0.11
379 0.11
380 0.1
381 0.13
382 0.14
383 0.17
384 0.23
385 0.25
386 0.29
387 0.33
388 0.36
389 0.36
390 0.4
391 0.38
392 0.37
393 0.39
394 0.36
395 0.4
396 0.44
397 0.44
398 0.43
399 0.42
400 0.4
401 0.37
402 0.36
403 0.3
404 0.23
405 0.2
406 0.18
407 0.17
408 0.15
409 0.13
410 0.11
411 0.09
412 0.11
413 0.1
414 0.1
415 0.12
416 0.13
417 0.13
418 0.15
419 0.17
420 0.18
421 0.18
422 0.17
423 0.18
424 0.16
425 0.16
426 0.14
427 0.1
428 0.07
429 0.07
430 0.07
431 0.05
432 0.05
433 0.05
434 0.05
435 0.05
436 0.06
437 0.06
438 0.07
439 0.06
440 0.06
441 0.06
442 0.07
443 0.07
444 0.07
445 0.08
446 0.08
447 0.08
448 0.08
449 0.09
450 0.1
451 0.12
452 0.12
453 0.15
454 0.22
455 0.26
456 0.29
457 0.3
458 0.34
459 0.36
460 0.4
461 0.37
462 0.33
463 0.3
464 0.26
465 0.28
466 0.24
467 0.22
468 0.22
469 0.26
470 0.3
471 0.31
472 0.31
473 0.28
474 0.3
475 0.36
476 0.34
477 0.37
478 0.32
479 0.39
480 0.43
481 0.47
482 0.46
483 0.42
484 0.42
485 0.42
486 0.42
487 0.43
488 0.44
489 0.41
490 0.41
491 0.38
492 0.36
493 0.3
494 0.28
495 0.23
496 0.19
497 0.19
498 0.21
499 0.2
500 0.2
501 0.18
502 0.17
503 0.14
504 0.16
505 0.2
506 0.24
507 0.31
508 0.38
509 0.47
510 0.49
511 0.5
512 0.55
513 0.57
514 0.58
515 0.58
516 0.6
517 0.53
518 0.53
519 0.52
520 0.44
521 0.37
522 0.3
523 0.21
524 0.11
525 0.1
526 0.08
527 0.08
528 0.06
529 0.06
530 0.07
531 0.08
532 0.09
533 0.09
534 0.1