FuNGI

A0A0A1SNP4

Protein Details

Accession

A0A0A1SNP4

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
190-213	SQTPPPPKPKPSPQPKSPRPDAKG	Hydrophilic
361-385	DSYSYRPYDKPKQPQRKKSNGSLAS	Hydrophilic

NLS Segment(s)

Position	Sequence
195-280	PPKPKPSPQPKSPRPDAKGSWEKARDEMRKKEEERKAKAAEQKRREEISKRLAELRAKEAKERLQREKDKEKKEKEIKEAAEKKAA

Subcellular Location(s)

plas 15, nucl 4.5, mito 4, cyto_nucl 3.5, cyto 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR037651 Swc3
Gene Ontology	GO:0016020 C:membrane GO:0000812 C:Swr1 complex GO:0140849 F:ATP-dependent H2AZ histone chaperone activity

Amino Acid Sequences

MNAPPPPPPPHGEMPRSSSGLPPGKYDIFVIPEHSAGSGFLYLPSLKPNINSFVAGFASALILVVLFQSITPAFRVWWDSFHGLGNMAMLMLLVGVGFGAWALGRTQNDAGNNNSGSKKREPPNTNGNAGTQPGGQGGFENGHSRGTSNSSAPPPHSPPPPPPPPPNGGGPGPGPSTWDSGSPPNYQYQSQTPPPPKPKPSPQPKSPRPDAKGSWEKARDEMRKKEEERKAKAAEQKRREEISKRLAELRAKEAKERLQREKDKEKKEKEIKEAAEKKAAAAAAAATAKAAASTPSTPAAPPPRAQSSYAYSGVGEKMNMWPNGKPPTPPTHTNTTPKSPASPTKRPPAPTARTYLSTDEDSYSYRPYDKPKQPQRKKSNGSLASDVSWANSHTTARTSPPPSVRGPYTTKDPDKIVIQAVYMFMNQFAKTPASQLISGVGSVTDGLILRITTEGLFIDDDVRGVPQREWDVKGWTLKLVETGEWKTKGLHLLRATVKDQDGKRYLFVIDETEYWKVGASIQRLRRGTQARQLGVAAMTAAEARTTLDTLGWTD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.58
2	0.59
3	0.57
4	0.51
5	0.45
6	0.45
7	0.46
8	0.42
9	0.39
10	0.39
11	0.38
12	0.38
13	0.37
14	0.31
15	0.27
16	0.26
17	0.27
18	0.22
19	0.21
20	0.21
21	0.19
22	0.16
23	0.12
24	0.13
25	0.1
26	0.09
27	0.09
28	0.11
29	0.12
30	0.12
31	0.15
32	0.16
33	0.16
34	0.19
35	0.22
36	0.25
37	0.26
38	0.27
39	0.24
40	0.24
41	0.23
42	0.21
43	0.17
44	0.11
45	0.1
46	0.08
47	0.08
48	0.05
49	0.04
50	0.04
51	0.04
52	0.04
53	0.03
54	0.03
55	0.05
56	0.06
57	0.07
58	0.08
59	0.09
60	0.09
61	0.12
62	0.17
63	0.16
64	0.18
65	0.23
66	0.24
67	0.24
68	0.25
69	0.24
70	0.19
71	0.18
72	0.16
73	0.11
74	0.08
75	0.07
76	0.05
77	0.04
78	0.03
79	0.03
80	0.02
81	0.02
82	0.02
83	0.02
84	0.02
85	0.02
86	0.02
87	0.02
88	0.03
89	0.04
90	0.08
91	0.08
92	0.12
93	0.14
94	0.16
95	0.2
96	0.22
97	0.24
98	0.25
99	0.26
100	0.27
101	0.29
102	0.29
103	0.31
104	0.35
105	0.41
106	0.44
107	0.53
108	0.55
109	0.58
110	0.66
111	0.67
112	0.64
113	0.56
114	0.51
115	0.43
116	0.38
117	0.33
118	0.22
119	0.17
120	0.13
121	0.12
122	0.1
123	0.08
124	0.09
125	0.09
126	0.09
127	0.11
128	0.11
129	0.12
130	0.12
131	0.12
132	0.13
133	0.16
134	0.17
135	0.17
136	0.21
137	0.23
138	0.25
139	0.27
140	0.31
141	0.32
142	0.35
143	0.38
144	0.37
145	0.41
146	0.48
147	0.54
148	0.55
149	0.55
150	0.56
151	0.54
152	0.54
153	0.5
154	0.45
155	0.37
156	0.33
157	0.28
158	0.25
159	0.22
160	0.19
161	0.18
162	0.15
163	0.17
164	0.15
165	0.16
166	0.15
167	0.18
168	0.22
169	0.22
170	0.22
171	0.24
172	0.26
173	0.25
174	0.26
175	0.27
176	0.3
177	0.32
178	0.39
179	0.4
180	0.47
181	0.55
182	0.6
183	0.61
184	0.63
185	0.68
186	0.71
187	0.77
188	0.77
189	0.78
190	0.81
191	0.83
192	0.84
193	0.82
194	0.81
195	0.74
196	0.72
197	0.65
198	0.63
199	0.64
200	0.58
201	0.57
202	0.51
203	0.48
204	0.46
205	0.52
206	0.5
207	0.48
208	0.54
209	0.53
210	0.57
211	0.59
212	0.65
213	0.65
214	0.66
215	0.65
216	0.64
217	0.61
218	0.59
219	0.64
220	0.63
221	0.64
222	0.63
223	0.63
224	0.6
225	0.6
226	0.58
227	0.54
228	0.52
229	0.52
230	0.48
231	0.43
232	0.41
233	0.42
234	0.42
235	0.39
236	0.39
237	0.37
238	0.34
239	0.34
240	0.34
241	0.37
242	0.42
243	0.46
244	0.47
245	0.49
246	0.56
247	0.61
248	0.69
249	0.71
250	0.73
251	0.77
252	0.74
253	0.74
254	0.76
255	0.75
256	0.7
257	0.69
258	0.61
259	0.62
260	0.63
261	0.55
262	0.5
263	0.44
264	0.37
265	0.32
266	0.29
267	0.19
268	0.12
269	0.1
270	0.07
271	0.07
272	0.07
273	0.04
274	0.04
275	0.04
276	0.04
277	0.04
278	0.03
279	0.05
280	0.05
281	0.07
282	0.08
283	0.08
284	0.08
285	0.12
286	0.18
287	0.18
288	0.19
289	0.22
290	0.26
291	0.28
292	0.29
293	0.28
294	0.26
295	0.29
296	0.29
297	0.25
298	0.2
299	0.19
300	0.19
301	0.16
302	0.12
303	0.08
304	0.11
305	0.16
306	0.18
307	0.18
308	0.18
309	0.22
310	0.28
311	0.28
312	0.25
313	0.25
314	0.31
315	0.35
316	0.39
317	0.38
318	0.41
319	0.45
320	0.5
321	0.51
322	0.48
323	0.47
324	0.43
325	0.42
326	0.38
327	0.42
328	0.43
329	0.48
330	0.48
331	0.54
332	0.58
333	0.58
334	0.6
335	0.61
336	0.58
337	0.53
338	0.53
339	0.46
340	0.44
341	0.44
342	0.4
343	0.33
344	0.28
345	0.26
346	0.21
347	0.19
348	0.18
349	0.17
350	0.16
351	0.14
352	0.15
353	0.17
354	0.23
355	0.33
356	0.4
357	0.5
358	0.59
359	0.7
360	0.78
361	0.86
362	0.89
363	0.9
364	0.87
365	0.85
366	0.85
367	0.79
368	0.73
369	0.65
370	0.56
371	0.46
372	0.41
373	0.32
374	0.22
375	0.17
376	0.13
377	0.11
378	0.11
379	0.11
380	0.1
381	0.13
382	0.14
383	0.17
384	0.23
385	0.25
386	0.29
387	0.33
388	0.36
389	0.36
390	0.4
391	0.38
392	0.37
393	0.39
394	0.36
395	0.4
396	0.44
397	0.44
398	0.43
399	0.42
400	0.4
401	0.37
402	0.36
403	0.3
404	0.23
405	0.2
406	0.18
407	0.17
408	0.15
409	0.13
410	0.11
411	0.09
412	0.11
413	0.1
414	0.1
415	0.12
416	0.13
417	0.13
418	0.15
419	0.17
420	0.18
421	0.18
422	0.17
423	0.18
424	0.16
425	0.16
426	0.14
427	0.1
428	0.07
429	0.07
430	0.07
431	0.05
432	0.05
433	0.05
434	0.05
435	0.05
436	0.06
437	0.06
438	0.07
439	0.06
440	0.06
441	0.06
442	0.07
443	0.07
444	0.07
445	0.08
446	0.08
447	0.08
448	0.08
449	0.09
450	0.1
451	0.12
452	0.12
453	0.15
454	0.22
455	0.26
456	0.29
457	0.3
458	0.34
459	0.36
460	0.4
461	0.37
462	0.33
463	0.3
464	0.26
465	0.28
466	0.24
467	0.22
468	0.22
469	0.26
470	0.3
471	0.31
472	0.31
473	0.28
474	0.3
475	0.36
476	0.34
477	0.37
478	0.32
479	0.39
480	0.43
481	0.47
482	0.46
483	0.42
484	0.42
485	0.42
486	0.42
487	0.43
488	0.44
489	0.41
490	0.41
491	0.38
492	0.36
493	0.3
494	0.28
495	0.23
496	0.19
497	0.19
498	0.21
499	0.2
500	0.2
501	0.18
502	0.17
503	0.14
504	0.16
505	0.2
506	0.24
507	0.31
508	0.38
509	0.47
510	0.49
511	0.5
512	0.55
513	0.57
514	0.58
515	0.58
516	0.6
517	0.53
518	0.53
519	0.52
520	0.44
521	0.37
522	0.3
523	0.21
524	0.11
525	0.1
526	0.08
527	0.08
528	0.06
529	0.06
530	0.07
531	0.08
532	0.09
533	0.09
534	0.1

A0A0A1SNP4

3D AlphaFold-predicted Structure Viewer