Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P39015

Protein Details
Accession P39015   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-61PPPSADPSKARKNRPRPSGNEGAIHydrophilic
NLS Segment(s)
PositionSequence
44-72PSKARKNRPRPSGNEGAIRDKTAGRRNNR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0048471  C:perinuclear region of cytoplasm  
GO:0005844  C:polysome  
GO:0003677  F:DNA binding  
GO:0043022  F:ribosome binding  
GO:0003723  F:RNA binding  
GO:0042162  F:telomeric DNA binding  
GO:0061770  F:translation elongation factor binding  
GO:0030371  F:translation repressor activity  
GO:0045142  F:triplex DNA binding  
GO:0043066  P:negative regulation of apoptotic process  
GO:0043558  P:regulation of translational initiation in response to stress  
GO:0000723  P:telomere maintenance  
GO:0031929  P:TOR signaling  
GO:0006414  P:translational elongation  
KEGG sce:YLR150W  -  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
PF09598  Stm1_N  
Amino Acid Sequences MSNPFDLLGNDVEDADVVVLPPKEIVKSNTSSKKADVPPPSADPSKARKNRPRPSGNEGAIRDKTAGRRNNRSKDVTDSATTKKSNTRRATDRHSRTGKTDTKKKVNQGWGDDKKELSAEKEAQADAAAEIAEDAAEAEDAGKPKTAQLSLQDYLNQQANNQFNKVPEAKKVELDAERIETAEKEAYVPATKVKNVKSKQLKTKEYLEFDATFVESNTRKNFGDRNNNSRNNFNNRRGGRGARKGNNTANATNSANTVQKNRNIDVSNLPSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.06
4 0.05
5 0.09
6 0.09
7 0.09
8 0.1
9 0.11
10 0.13
11 0.16
12 0.2
13 0.22
14 0.27
15 0.37
16 0.45
17 0.48
18 0.48
19 0.48
20 0.53
21 0.53
22 0.57
23 0.54
24 0.5
25 0.51
26 0.53
27 0.56
28 0.49
29 0.45
30 0.43
31 0.44
32 0.5
33 0.53
34 0.59
35 0.64
36 0.73
37 0.8
38 0.84
39 0.85
40 0.81
41 0.82
42 0.81
43 0.75
44 0.72
45 0.65
46 0.61
47 0.53
48 0.47
49 0.4
50 0.33
51 0.36
52 0.36
53 0.41
54 0.42
55 0.52
56 0.61
57 0.68
58 0.72
59 0.7
60 0.65
61 0.65
62 0.62
63 0.54
64 0.47
65 0.42
66 0.39
67 0.4
68 0.37
69 0.32
70 0.35
71 0.38
72 0.45
73 0.48
74 0.52
75 0.54
76 0.6
77 0.67
78 0.7
79 0.69
80 0.69
81 0.69
82 0.63
83 0.59
84 0.62
85 0.6
86 0.58
87 0.6
88 0.59
89 0.63
90 0.66
91 0.69
92 0.68
93 0.68
94 0.64
95 0.62
96 0.64
97 0.61
98 0.6
99 0.55
100 0.47
101 0.39
102 0.35
103 0.29
104 0.21
105 0.18
106 0.16
107 0.16
108 0.17
109 0.17
110 0.16
111 0.15
112 0.13
113 0.08
114 0.07
115 0.05
116 0.03
117 0.03
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.04
127 0.05
128 0.05
129 0.06
130 0.06
131 0.07
132 0.09
133 0.09
134 0.09
135 0.13
136 0.19
137 0.19
138 0.2
139 0.2
140 0.19
141 0.2
142 0.22
143 0.18
144 0.12
145 0.17
146 0.22
147 0.21
148 0.23
149 0.22
150 0.2
151 0.24
152 0.28
153 0.24
154 0.24
155 0.29
156 0.29
157 0.29
158 0.3
159 0.3
160 0.27
161 0.28
162 0.24
163 0.19
164 0.18
165 0.17
166 0.16
167 0.12
168 0.12
169 0.11
170 0.09
171 0.08
172 0.08
173 0.09
174 0.1
175 0.1
176 0.14
177 0.15
178 0.18
179 0.22
180 0.28
181 0.36
182 0.37
183 0.47
184 0.53
185 0.59
186 0.67
187 0.72
188 0.72
189 0.67
190 0.74
191 0.71
192 0.65
193 0.59
194 0.52
195 0.43
196 0.38
197 0.34
198 0.26
199 0.19
200 0.15
201 0.16
202 0.13
203 0.17
204 0.2
205 0.22
206 0.22
207 0.26
208 0.32
209 0.37
210 0.47
211 0.5
212 0.57
213 0.64
214 0.71
215 0.7
216 0.7
217 0.69
218 0.68
219 0.7
220 0.68
221 0.67
222 0.61
223 0.65
224 0.64
225 0.65
226 0.65
227 0.66
228 0.68
229 0.67
230 0.72
231 0.72
232 0.73
233 0.73
234 0.68
235 0.6
236 0.53
237 0.49
238 0.44
239 0.38
240 0.33
241 0.27
242 0.26
243 0.26
244 0.3
245 0.33
246 0.37
247 0.42
248 0.43
249 0.47
250 0.46
251 0.47
252 0.48
253 0.48