Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CX47

Protein Details
Accession P0CX47    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
18-43HIFNNPKVKTSKRTKRWYKNAGLGFKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR032440  Ribosomal_S11_N  
IPR000266  Ribosomal_S17/S11  
IPR028333  Ribosomal_S17_arc-typ  
IPR019979  Ribosomal_S17_CS  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000028  P:ribosomal small subunit assembly  
KEGG sce:YBR048W  -  
sce:YDR025W  -  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
PF16205  Ribosomal_S17_N  
PROSITE View protein in PROSITE  
PS00056  RIBOSOMAL_S17  
Amino Acid Sequences MSTELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.49
4 0.49
5 0.56
6 0.57
7 0.6
8 0.7
9 0.62
10 0.6
11 0.6
12 0.58
13 0.59
14 0.65
15 0.67
16 0.66
17 0.74
18 0.8
19 0.86
20 0.91
21 0.91
22 0.88
23 0.86
24 0.83
25 0.8
26 0.72
27 0.65
28 0.6
29 0.51
30 0.45
31 0.37
32 0.3
33 0.27
34 0.25
35 0.21
36 0.2
37 0.21
38 0.22
39 0.31
40 0.3
41 0.27
42 0.28
43 0.28
44 0.23
45 0.24
46 0.21
47 0.13
48 0.2
49 0.22
50 0.28
51 0.29
52 0.29
53 0.27
54 0.26
55 0.25
56 0.18
57 0.15
58 0.07
59 0.05
60 0.06
61 0.06
62 0.07
63 0.08
64 0.09
65 0.1
66 0.11
67 0.11
68 0.11
69 0.13
70 0.19
71 0.26
72 0.3
73 0.29
74 0.29
75 0.32
76 0.33
77 0.34
78 0.34
79 0.29
80 0.31
81 0.32
82 0.39
83 0.42
84 0.48
85 0.53
86 0.54
87 0.62
88 0.66
89 0.73
90 0.74
91 0.76
92 0.76
93 0.76
94 0.76
95 0.7
96 0.65
97 0.59
98 0.51
99 0.44
100 0.41
101 0.33
102 0.25
103 0.21
104 0.16
105 0.17
106 0.16
107 0.15
108 0.1
109 0.11
110 0.11
111 0.11
112 0.11
113 0.11
114 0.1
115 0.11
116 0.14
117 0.2
118 0.26
119 0.32
120 0.42
121 0.42
122 0.52
123 0.53
124 0.5
125 0.52
126 0.49
127 0.44
128 0.35
129 0.34
130 0.26
131 0.26
132 0.29
133 0.23
134 0.27
135 0.3
136 0.37