Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q07074

Protein Details
Accession Q07074    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MHRKKRKKEKKRTEKDNTTNLPPBasic
NLS Segment(s)
PositionSequence
3-13RKKRKKEKKRT
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG sce:YHR007C-A  -  
Amino Acid Sequences MHRKKRKKEKKRTEKDNTTNLPPLFLFPCSLSLPTLLAPVHYIPTRLTHHQAENQLFLLLFQPIIVKPLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.93
3 0.91
4 0.85
5 0.79
6 0.75
7 0.64
8 0.54
9 0.43
10 0.36
11 0.27
12 0.23
13 0.18
14 0.12
15 0.15
16 0.14
17 0.14
18 0.12
19 0.11
20 0.11
21 0.1
22 0.11
23 0.08
24 0.07
25 0.07
26 0.07
27 0.09
28 0.09
29 0.09
30 0.09
31 0.14
32 0.18
33 0.2
34 0.24
35 0.26
36 0.3
37 0.34
38 0.41
39 0.38
40 0.36
41 0.33
42 0.29
43 0.25
44 0.22
45 0.18
46 0.11
47 0.09
48 0.07
49 0.08
50 0.08
51 0.11