Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TN55

Protein Details
Accession A0A0A1TN55    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
525-559APAEAPKRSDSKKKREKKPLPPVGRTQRKTRSQGPBasic
NLS Segment(s)
PositionSequence
530-555PKRSDSKKKREKKPLPPVGRTQRKTR
Subcellular Location(s) cyto 13.5, cyto_nucl 12.833, nucl 11, mito_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MADSFHHGFNGVGTAHHQVSHQAHQPPPVEPQSNMDDKLPPFVAICPPAPPERHHEQFQHLDPLPTATAPSIPSAPATAPIDMADKLPSVVGNASQAVEADGFERIKYAPHAKPFKLDTSDAPLTTWGEPEQAKPSESHTAPAPAAAAPAVAPAAPAAAAPKEAHKDEAPKPAAPAAPKSVDEPVQSIAELSKPTEPPKTLEPVKPFEAPQQAESKPVPVAQPFEAPAPQSFNQPDTTPKPIEVAKPVEQPKLDETPKPPAETAKPVEPAPKPVEVTKPAEPAKPVEIAKPVEKPVEVSKPAEAPKPVELPKPAEAPKPAEVSKPVEAPKPVEVSKPVEAPKPVEASKPVEVSKPVEAPKPVEAPKPVEASKPVEAPKPVEVAKPAEAPKPPAAASIVDALKPAAAHLPKPVEVLSVPDTPVDMRTPAGGTPRPELKIPEEPLQPPKAEEPAAPAEDVEMTEVDAAPVPAAAPAAPAPAPSVTSESSTGEKRKADEVSAPAEPAEKKVKLDEPAAAPTNGSTETAPAEAPKRSDSKKKREKKPLPPVGRTQRKTRSQGPAETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.18
5 0.21
6 0.26
7 0.32
8 0.37
9 0.39
10 0.41
11 0.47
12 0.49
13 0.44
14 0.47
15 0.48
16 0.44
17 0.38
18 0.4
19 0.4
20 0.43
21 0.42
22 0.37
23 0.35
24 0.32
25 0.37
26 0.33
27 0.27
28 0.23
29 0.25
30 0.28
31 0.26
32 0.26
33 0.23
34 0.26
35 0.31
36 0.32
37 0.33
38 0.35
39 0.4
40 0.45
41 0.48
42 0.48
43 0.51
44 0.56
45 0.57
46 0.58
47 0.5
48 0.46
49 0.41
50 0.39
51 0.32
52 0.25
53 0.22
54 0.13
55 0.14
56 0.13
57 0.15
58 0.13
59 0.13
60 0.13
61 0.14
62 0.13
63 0.16
64 0.17
65 0.16
66 0.15
67 0.15
68 0.17
69 0.16
70 0.17
71 0.13
72 0.11
73 0.11
74 0.11
75 0.1
76 0.09
77 0.09
78 0.09
79 0.1
80 0.11
81 0.11
82 0.1
83 0.1
84 0.1
85 0.09
86 0.09
87 0.07
88 0.09
89 0.09
90 0.09
91 0.1
92 0.09
93 0.11
94 0.16
95 0.23
96 0.26
97 0.35
98 0.43
99 0.43
100 0.49
101 0.51
102 0.52
103 0.49
104 0.46
105 0.39
106 0.4
107 0.42
108 0.36
109 0.32
110 0.27
111 0.25
112 0.24
113 0.22
114 0.14
115 0.14
116 0.15
117 0.17
118 0.22
119 0.21
120 0.21
121 0.21
122 0.24
123 0.29
124 0.29
125 0.28
126 0.24
127 0.26
128 0.25
129 0.24
130 0.21
131 0.13
132 0.13
133 0.11
134 0.09
135 0.05
136 0.06
137 0.05
138 0.04
139 0.04
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.06
147 0.07
148 0.1
149 0.14
150 0.15
151 0.18
152 0.19
153 0.25
154 0.29
155 0.38
156 0.38
157 0.35
158 0.35
159 0.35
160 0.36
161 0.31
162 0.29
163 0.24
164 0.24
165 0.24
166 0.24
167 0.24
168 0.24
169 0.23
170 0.21
171 0.18
172 0.16
173 0.15
174 0.14
175 0.11
176 0.11
177 0.11
178 0.1
179 0.13
180 0.14
181 0.17
182 0.21
183 0.21
184 0.22
185 0.25
186 0.31
187 0.32
188 0.36
189 0.39
190 0.39
191 0.41
192 0.4
193 0.38
194 0.36
195 0.38
196 0.33
197 0.31
198 0.32
199 0.29
200 0.31
201 0.3
202 0.26
203 0.2
204 0.2
205 0.19
206 0.14
207 0.17
208 0.15
209 0.16
210 0.15
211 0.16
212 0.15
213 0.15
214 0.14
215 0.17
216 0.16
217 0.18
218 0.18
219 0.18
220 0.19
221 0.19
222 0.23
223 0.22
224 0.26
225 0.23
226 0.22
227 0.23
228 0.23
229 0.25
230 0.25
231 0.26
232 0.24
233 0.31
234 0.33
235 0.33
236 0.32
237 0.31
238 0.3
239 0.31
240 0.3
241 0.26
242 0.26
243 0.33
244 0.34
245 0.34
246 0.31
247 0.27
248 0.28
249 0.31
250 0.31
251 0.26
252 0.26
253 0.25
254 0.3
255 0.28
256 0.3
257 0.26
258 0.26
259 0.23
260 0.23
261 0.26
262 0.24
263 0.28
264 0.26
265 0.29
266 0.28
267 0.28
268 0.27
269 0.25
270 0.23
271 0.23
272 0.21
273 0.17
274 0.19
275 0.2
276 0.21
277 0.22
278 0.21
279 0.18
280 0.18
281 0.18
282 0.18
283 0.22
284 0.22
285 0.2
286 0.2
287 0.23
288 0.25
289 0.26
290 0.22
291 0.18
292 0.2
293 0.24
294 0.24
295 0.23
296 0.24
297 0.25
298 0.27
299 0.3
300 0.29
301 0.27
302 0.27
303 0.28
304 0.29
305 0.29
306 0.28
307 0.24
308 0.25
309 0.26
310 0.26
311 0.26
312 0.24
313 0.23
314 0.24
315 0.24
316 0.25
317 0.24
318 0.23
319 0.21
320 0.22
321 0.23
322 0.24
323 0.26
324 0.25
325 0.24
326 0.24
327 0.25
328 0.25
329 0.25
330 0.24
331 0.22
332 0.23
333 0.24
334 0.26
335 0.26
336 0.24
337 0.22
338 0.23
339 0.24
340 0.24
341 0.23
342 0.22
343 0.22
344 0.23
345 0.23
346 0.25
347 0.28
348 0.27
349 0.27
350 0.28
351 0.29
352 0.32
353 0.34
354 0.31
355 0.27
356 0.28
357 0.29
358 0.28
359 0.29
360 0.27
361 0.26
362 0.27
363 0.28
364 0.27
365 0.26
366 0.25
367 0.22
368 0.22
369 0.22
370 0.23
371 0.25
372 0.25
373 0.26
374 0.26
375 0.29
376 0.29
377 0.28
378 0.26
379 0.22
380 0.22
381 0.18
382 0.18
383 0.19
384 0.17
385 0.15
386 0.15
387 0.13
388 0.13
389 0.12
390 0.11
391 0.11
392 0.11
393 0.12
394 0.16
395 0.19
396 0.19
397 0.21
398 0.21
399 0.16
400 0.15
401 0.19
402 0.18
403 0.17
404 0.17
405 0.16
406 0.16
407 0.15
408 0.16
409 0.14
410 0.1
411 0.09
412 0.1
413 0.11
414 0.12
415 0.17
416 0.19
417 0.2
418 0.24
419 0.29
420 0.3
421 0.3
422 0.32
423 0.32
424 0.37
425 0.39
426 0.4
427 0.4
428 0.41
429 0.46
430 0.47
431 0.42
432 0.35
433 0.34
434 0.31
435 0.28
436 0.25
437 0.24
438 0.26
439 0.27
440 0.25
441 0.22
442 0.19
443 0.18
444 0.18
445 0.13
446 0.07
447 0.06
448 0.07
449 0.07
450 0.07
451 0.07
452 0.07
453 0.05
454 0.05
455 0.05
456 0.05
457 0.05
458 0.05
459 0.05
460 0.06
461 0.08
462 0.08
463 0.08
464 0.1
465 0.1
466 0.11
467 0.11
468 0.14
469 0.13
470 0.16
471 0.17
472 0.18
473 0.21
474 0.25
475 0.28
476 0.29
477 0.31
478 0.31
479 0.35
480 0.35
481 0.34
482 0.34
483 0.34
484 0.35
485 0.34
486 0.31
487 0.26
488 0.28
489 0.26
490 0.25
491 0.28
492 0.25
493 0.25
494 0.31
495 0.36
496 0.36
497 0.38
498 0.39
499 0.35
500 0.4
501 0.42
502 0.36
503 0.31
504 0.27
505 0.27
506 0.22
507 0.19
508 0.13
509 0.11
510 0.13
511 0.13
512 0.13
513 0.14
514 0.17
515 0.19
516 0.22
517 0.25
518 0.31
519 0.37
520 0.48
521 0.55
522 0.63
523 0.71
524 0.79
525 0.85
526 0.89
527 0.93
528 0.93
529 0.94
530 0.94
531 0.93
532 0.9
533 0.9
534 0.9
535 0.9
536 0.84
537 0.82
538 0.82
539 0.81
540 0.81
541 0.8
542 0.79
543 0.76