Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TF13

Protein Details
Accession A0A0A1TF13   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-62IEFNKKDKRENVKDNRRWEDBasic
NLS Segment(s)
Subcellular Location(s) cyto 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036928  AS_sf  
Amino Acid Sequences MPGVKKVSGLWDRLGAAFVPNIAAYLKELEVNPNKVTNLRELIEFNKKDKRENVKDNRRWEDALALGYDNTSPRFHDAGPEGFTGAIEKHKLDFILAEMQILAYATPYIGGPAMAVPMKTQGKHPVALGITGPLFGEEKMIQVAYAYEQKTMAQRDKKPTNMPKTELKDVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.21
3 0.17
4 0.15
5 0.12
6 0.1
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.09
13 0.1
14 0.11
15 0.11
16 0.18
17 0.24
18 0.27
19 0.28
20 0.28
21 0.28
22 0.29
23 0.3
24 0.27
25 0.26
26 0.23
27 0.23
28 0.23
29 0.27
30 0.34
31 0.34
32 0.33
33 0.37
34 0.37
35 0.41
36 0.47
37 0.53
38 0.53
39 0.62
40 0.69
41 0.73
42 0.79
43 0.83
44 0.8
45 0.73
46 0.64
47 0.54
48 0.45
49 0.35
50 0.28
51 0.2
52 0.14
53 0.11
54 0.1
55 0.1
56 0.08
57 0.08
58 0.08
59 0.08
60 0.1
61 0.12
62 0.12
63 0.14
64 0.16
65 0.17
66 0.18
67 0.18
68 0.15
69 0.14
70 0.13
71 0.11
72 0.09
73 0.08
74 0.06
75 0.07
76 0.07
77 0.08
78 0.08
79 0.07
80 0.07
81 0.07
82 0.11
83 0.11
84 0.1
85 0.09
86 0.09
87 0.09
88 0.09
89 0.07
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.06
103 0.06
104 0.12
105 0.14
106 0.14
107 0.17
108 0.24
109 0.27
110 0.28
111 0.28
112 0.27
113 0.25
114 0.25
115 0.23
116 0.16
117 0.13
118 0.12
119 0.12
120 0.08
121 0.08
122 0.07
123 0.1
124 0.08
125 0.09
126 0.1
127 0.1
128 0.09
129 0.09
130 0.09
131 0.09
132 0.15
133 0.15
134 0.15
135 0.15
136 0.17
137 0.23
138 0.28
139 0.34
140 0.37
141 0.44
142 0.54
143 0.62
144 0.67
145 0.72
146 0.76
147 0.78
148 0.77
149 0.74
150 0.74
151 0.73