Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1TAS3

Protein Details
Accession A0A0A1TAS3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSEKPRTKDKEKDKSKVHKLSLKGBasic
NLS Segment(s)
PositionSequence
12-12K
14-14K
Subcellular Location(s) mito 16, mito_nucl 11.833, cyto_mito 9.833, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003511  HORMA_dom  
IPR036570  HORMA_dom_sf  
IPR045091  Mad2-like  
Pfam View protein in Pfam  
PF02301  HORMA  
PROSITE View protein in PROSITE  
PS50815  HORMA  
Amino Acid Sequences MSEKPRTKDKEKDKSKVHKLSLKGSSRLVAEFFQYSIHTILFQRGVYPAEDFTAVKKYGLNMLVSSDDQVKAYIKKIMSQLDKWMLSGQISRLVIVITDKDTGEHVERWQFNVDISAPAKSSKSSKSSTSRDKENSAAAGAPKEEKTETEIQSEIAAIFRQITASVTFLPQLSGNCTFNVLVYADADSEVPVEWGDSDAKEIEGGERVQLRGFSTANHRVDTLVSYRLGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.89
4 0.86
5 0.82
6 0.76
7 0.76
8 0.76
9 0.71
10 0.64
11 0.56
12 0.51
13 0.46
14 0.42
15 0.35
16 0.26
17 0.21
18 0.19
19 0.17
20 0.15
21 0.14
22 0.14
23 0.14
24 0.13
25 0.12
26 0.12
27 0.15
28 0.16
29 0.15
30 0.14
31 0.15
32 0.16
33 0.15
34 0.16
35 0.13
36 0.12
37 0.13
38 0.12
39 0.13
40 0.17
41 0.16
42 0.15
43 0.16
44 0.16
45 0.19
46 0.21
47 0.2
48 0.15
49 0.16
50 0.17
51 0.17
52 0.17
53 0.14
54 0.12
55 0.11
56 0.12
57 0.13
58 0.12
59 0.14
60 0.17
61 0.16
62 0.19
63 0.23
64 0.28
65 0.3
66 0.3
67 0.34
68 0.35
69 0.35
70 0.32
71 0.29
72 0.22
73 0.19
74 0.19
75 0.14
76 0.14
77 0.14
78 0.13
79 0.12
80 0.12
81 0.11
82 0.1
83 0.1
84 0.06
85 0.08
86 0.07
87 0.07
88 0.08
89 0.1
90 0.11
91 0.11
92 0.11
93 0.16
94 0.17
95 0.18
96 0.19
97 0.17
98 0.15
99 0.15
100 0.15
101 0.11
102 0.11
103 0.1
104 0.09
105 0.1
106 0.1
107 0.1
108 0.12
109 0.14
110 0.18
111 0.19
112 0.25
113 0.32
114 0.39
115 0.48
116 0.49
117 0.52
118 0.51
119 0.51
120 0.47
121 0.41
122 0.35
123 0.26
124 0.23
125 0.16
126 0.14
127 0.12
128 0.12
129 0.11
130 0.11
131 0.11
132 0.1
133 0.15
134 0.21
135 0.21
136 0.22
137 0.22
138 0.2
139 0.2
140 0.2
141 0.15
142 0.09
143 0.08
144 0.05
145 0.06
146 0.05
147 0.05
148 0.05
149 0.07
150 0.07
151 0.08
152 0.09
153 0.09
154 0.1
155 0.09
156 0.1
157 0.1
158 0.1
159 0.13
160 0.16
161 0.17
162 0.16
163 0.18
164 0.17
165 0.16
166 0.16
167 0.13
168 0.09
169 0.09
170 0.09
171 0.08
172 0.08
173 0.08
174 0.06
175 0.06
176 0.06
177 0.06
178 0.05
179 0.05
180 0.05
181 0.06
182 0.08
183 0.07
184 0.09
185 0.09
186 0.1
187 0.1
188 0.1
189 0.1
190 0.12
191 0.12
192 0.14
193 0.16
194 0.16
195 0.18
196 0.18
197 0.19
198 0.19
199 0.19
200 0.19
201 0.24
202 0.33
203 0.35
204 0.35
205 0.33
206 0.3
207 0.31
208 0.32
209 0.27
210 0.21