Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40034

Protein Details
Accession P40034    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-100AYALITQKGKRQRNKENPEDSHINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003347  JmjC_dom  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0032452  F:histone demethylase activity  
GO:0051864  F:histone H3K36 demethylase activity  
GO:0140680  F:histone H3K36me/H3K36me2 demethylase activity  
GO:0046872  F:metal ion binding  
GO:0035064  F:methylated histone binding  
GO:0003712  F:transcription coregulator activity  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0006482  P:protein demethylation  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG sce:YER051W  -  
PROSITE View protein in PROSITE  
PS51184  JMJC  
CDD cd15517  PHD_TCF19_like  
Amino Acid Sequences MQDPNICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYRCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDKMNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVGTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISLEVSNIEGLELERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSKKHLAKALADLIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.39
4 0.38
5 0.35
6 0.32
7 0.25
8 0.23
9 0.22
10 0.22
11 0.27
12 0.25
13 0.3
14 0.3
15 0.32
16 0.37
17 0.4
18 0.47
19 0.45
20 0.51
21 0.5
22 0.57
23 0.6
24 0.57
25 0.6
26 0.61
27 0.64
28 0.61
29 0.62
30 0.58
31 0.58
32 0.55
33 0.53
34 0.45
35 0.39
36 0.36
37 0.29
38 0.26
39 0.2
40 0.18
41 0.17
42 0.2
43 0.24
44 0.24
45 0.24
46 0.31
47 0.4
48 0.44
49 0.5
50 0.57
51 0.63
52 0.71
53 0.78
54 0.75
55 0.74
56 0.71
57 0.67
58 0.59
59 0.56
60 0.49
61 0.42
62 0.36
63 0.28
64 0.25
65 0.23
66 0.21
67 0.16
68 0.17
69 0.18
70 0.25
71 0.33
72 0.43
73 0.49
74 0.58
75 0.67
76 0.74
77 0.82
78 0.86
79 0.86
80 0.81
81 0.8
82 0.78
83 0.7
84 0.7
85 0.66
86 0.61
87 0.55
88 0.6
89 0.62
90 0.66
91 0.72
92 0.68
93 0.73
94 0.72
95 0.78
96 0.79
97 0.75
98 0.69
99 0.65
100 0.62
101 0.57
102 0.52
103 0.42
104 0.35
105 0.29
106 0.28
107 0.24
108 0.22
109 0.2
110 0.25
111 0.3
112 0.37
113 0.48
114 0.55
115 0.61
116 0.65
117 0.65
118 0.68
119 0.66
120 0.61
121 0.56
122 0.5
123 0.43
124 0.48
125 0.5
126 0.49
127 0.48
128 0.47
129 0.48
130 0.47
131 0.48
132 0.41
133 0.39
134 0.34
135 0.32
136 0.27
137 0.21
138 0.18
139 0.15
140 0.15
141 0.12
142 0.1
143 0.1
144 0.1
145 0.11
146 0.11
147 0.15
148 0.13
149 0.13
150 0.14
151 0.14
152 0.15
153 0.14
154 0.13
155 0.12
156 0.13
157 0.13
158 0.13
159 0.12
160 0.11
161 0.11
162 0.11
163 0.08
164 0.08
165 0.07
166 0.07
167 0.07
168 0.07
169 0.08
170 0.08
171 0.09
172 0.07
173 0.07
174 0.08
175 0.08
176 0.08
177 0.08
178 0.06
179 0.06
180 0.07
181 0.07
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.07
192 0.07
193 0.06
194 0.07
195 0.08
196 0.08
197 0.11
198 0.11
199 0.08
200 0.08
201 0.09
202 0.09
203 0.08
204 0.11
205 0.08
206 0.1
207 0.1
208 0.11
209 0.12
210 0.12
211 0.2
212 0.18
213 0.23
214 0.23
215 0.26
216 0.32
217 0.34
218 0.38
219 0.33
220 0.41
221 0.4
222 0.4
223 0.38
224 0.35
225 0.32
226 0.27
227 0.25
228 0.18
229 0.14
230 0.1
231 0.08
232 0.05
233 0.04
234 0.04
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.11
242 0.11
243 0.11
244 0.12
245 0.15
246 0.18
247 0.19
248 0.19
249 0.15
250 0.15
251 0.15
252 0.15
253 0.12
254 0.1
255 0.12
256 0.14
257 0.15
258 0.15
259 0.15
260 0.15
261 0.17
262 0.18
263 0.15
264 0.12
265 0.12
266 0.13
267 0.22
268 0.24
269 0.25
270 0.29
271 0.3
272 0.31
273 0.31
274 0.3
275 0.25
276 0.24
277 0.28
278 0.24
279 0.33
280 0.36
281 0.35
282 0.36
283 0.33
284 0.31
285 0.25
286 0.23
287 0.14
288 0.12
289 0.12
290 0.11
291 0.11
292 0.1
293 0.1
294 0.1
295 0.1
296 0.08
297 0.05
298 0.05
299 0.05
300 0.06
301 0.05
302 0.05
303 0.07
304 0.12
305 0.13
306 0.14
307 0.17
308 0.19
309 0.19
310 0.2
311 0.23
312 0.23
313 0.22
314 0.26
315 0.31
316 0.32
317 0.35
318 0.35
319 0.33
320 0.31
321 0.32
322 0.28
323 0.23
324 0.26
325 0.25
326 0.25
327 0.26
328 0.26
329 0.28
330 0.29
331 0.29
332 0.22
333 0.23
334 0.22
335 0.19
336 0.15
337 0.11
338 0.1
339 0.08
340 0.08
341 0.05
342 0.05
343 0.04
344 0.04
345 0.04
346 0.03
347 0.03
348 0.03
349 0.02
350 0.03
351 0.03
352 0.03
353 0.02
354 0.02
355 0.03
356 0.03
357 0.03
358 0.03
359 0.03
360 0.04
361 0.04
362 0.04
363 0.05
364 0.05
365 0.06
366 0.07
367 0.08
368 0.07
369 0.07
370 0.07
371 0.07
372 0.07
373 0.09
374 0.08
375 0.08
376 0.07
377 0.08
378 0.08
379 0.08
380 0.09
381 0.07
382 0.08
383 0.1
384 0.14
385 0.16
386 0.18
387 0.2
388 0.18
389 0.18
390 0.18
391 0.17
392 0.2
393 0.2
394 0.2
395 0.2
396 0.24
397 0.28
398 0.35
399 0.37
400 0.39
401 0.41
402 0.48
403 0.53
404 0.56
405 0.62
406 0.59
407 0.65
408 0.6
409 0.59
410 0.54
411 0.51
412 0.52
413 0.44
414 0.4
415 0.31
416 0.27
417 0.26
418 0.23
419 0.24
420 0.24
421 0.27
422 0.27
423 0.28
424 0.31
425 0.29
426 0.3
427 0.26
428 0.21
429 0.2
430 0.21
431 0.22
432 0.21
433 0.2
434 0.2
435 0.2
436 0.19
437 0.15
438 0.14
439 0.14
440 0.14
441 0.17
442 0.16
443 0.18
444 0.18
445 0.18
446 0.23
447 0.23
448 0.25
449 0.25
450 0.25
451 0.23
452 0.3
453 0.32
454 0.28
455 0.33
456 0.35
457 0.39
458 0.47
459 0.5
460 0.52
461 0.56
462 0.65
463 0.65
464 0.65
465 0.69
466 0.7
467 0.72
468 0.66
469 0.65
470 0.59
471 0.57
472 0.59