FuNGI

P40034

Protein Details

Accession

P40034

Localization Confidence

Low

Confidence Score

9.2

NoLS Segment(s)

Position	Sequence	Protein Nature
77-100	AYALITQKGKRQRNKENPEDSHIN	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16.5, cyto_nucl 13.5, cyto 9.5

Family & Domain DBs

InterPro	View protein in InterPro IPR003347 JmjC_dom IPR011011 Znf_FYVE_PHD IPR001965 Znf_PHD IPR013083 Znf_RING/FYVE/PHD
Gene Ontology	GO:0005634 C:nucleus GO:0032452 F:histone demethylase activity GO:0051864 F:histone H3K36 demethylase activity GO:0140680 F:histone H3K36me/H3K36me2 demethylase activity GO:0046872 F:metal ion binding GO:0035064 F:methylated histone binding GO:0003712 F:transcription coregulator activity GO:0032968 P:positive regulation of transcription elongation by RNA polymerase II GO:0006482 P:protein demethylation GO:0006357 P:regulation of transcription by RNA polymerase II
KEGG	sce:YER051W -
PROSITE	View protein in PROSITE PS51184 JMJC
CDD	cd15517 PHD_TCF19_like

Amino Acid Sequences

MQDPNICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYRCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDKMNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVGTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISLEVSNIEGLELERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSKKHLAKALADLIS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.46
3	0.39
4	0.38
5	0.35
6	0.32
7	0.25
8	0.23
9	0.22
10	0.22
11	0.27
12	0.25
13	0.3
14	0.3
15	0.32
16	0.37
17	0.4
18	0.47
19	0.45
20	0.51
21	0.5
22	0.57
23	0.6
24	0.57
25	0.6
26	0.61
27	0.64
28	0.61
29	0.62
30	0.58
31	0.58
32	0.55
33	0.53
34	0.45
35	0.39
36	0.36
37	0.29
38	0.26
39	0.2
40	0.18
41	0.17
42	0.2
43	0.24
44	0.24
45	0.24
46	0.31
47	0.4
48	0.44
49	0.5
50	0.57
51	0.63
52	0.71
53	0.78
54	0.75
55	0.74
56	0.71
57	0.67
58	0.59
59	0.56
60	0.49
61	0.42
62	0.36
63	0.28
64	0.25
65	0.23
66	0.21
67	0.16
68	0.17
69	0.18
70	0.25
71	0.33
72	0.43
73	0.49
74	0.58
75	0.67
76	0.74
77	0.82
78	0.86
79	0.86
80	0.81
81	0.8
82	0.78
83	0.7
84	0.7
85	0.66
86	0.61
87	0.55
88	0.6
89	0.62
90	0.66
91	0.72
92	0.68
93	0.73
94	0.72
95	0.78
96	0.79
97	0.75
98	0.69
99	0.65
100	0.62
101	0.57
102	0.52
103	0.42
104	0.35
105	0.29
106	0.28
107	0.24
108	0.22
109	0.2
110	0.25
111	0.3
112	0.37
113	0.48
114	0.55
115	0.61
116	0.65
117	0.65
118	0.68
119	0.66
120	0.61
121	0.56
122	0.5
123	0.43
124	0.48
125	0.5
126	0.49
127	0.48
128	0.47
129	0.48
130	0.47
131	0.48
132	0.41
133	0.39
134	0.34
135	0.32
136	0.27
137	0.21
138	0.18
139	0.15
140	0.15
141	0.12
142	0.1
143	0.1
144	0.1
145	0.11
146	0.11
147	0.15
148	0.13
149	0.13
150	0.14
151	0.14
152	0.15
153	0.14
154	0.13
155	0.12
156	0.13
157	0.13
158	0.13
159	0.12
160	0.11
161	0.11
162	0.11
163	0.08
164	0.08
165	0.07
166	0.07
167	0.07
168	0.07
169	0.08
170	0.08
171	0.09
172	0.07
173	0.07
174	0.08
175	0.08
176	0.08
177	0.08
178	0.06
179	0.06
180	0.07
181	0.07
182	0.06
183	0.06
184	0.05
185	0.05
186	0.05
187	0.05
188	0.04
189	0.04
190	0.04
191	0.07
192	0.07
193	0.06
194	0.07
195	0.08
196	0.08
197	0.11
198	0.11
199	0.08
200	0.08
201	0.09
202	0.09
203	0.08
204	0.11
205	0.08
206	0.1
207	0.1
208	0.11
209	0.12
210	0.12
211	0.2
212	0.18
213	0.23
214	0.23
215	0.26
216	0.32
217	0.34
218	0.38
219	0.33
220	0.41
221	0.4
222	0.4
223	0.38
224	0.35
225	0.32
226	0.27
227	0.25
228	0.18
229	0.14
230	0.1
231	0.08
232	0.05
233	0.04
234	0.04
235	0.05
236	0.05
237	0.05
238	0.05
239	0.05
240	0.06
241	0.11
242	0.11
243	0.11
244	0.12
245	0.15
246	0.18
247	0.19
248	0.19
249	0.15
250	0.15
251	0.15
252	0.15
253	0.12
254	0.1
255	0.12
256	0.14
257	0.15
258	0.15
259	0.15
260	0.15
261	0.17
262	0.18
263	0.15
264	0.12
265	0.12
266	0.13
267	0.22
268	0.24
269	0.25
270	0.29
271	0.3
272	0.31
273	0.31
274	0.3
275	0.25
276	0.24
277	0.28
278	0.24
279	0.33
280	0.36
281	0.35
282	0.36
283	0.33
284	0.31
285	0.25
286	0.23
287	0.14
288	0.12
289	0.12
290	0.11
291	0.11
292	0.1
293	0.1
294	0.1
295	0.1
296	0.08
297	0.05
298	0.05
299	0.05
300	0.06
301	0.05
302	0.05
303	0.07
304	0.12
305	0.13
306	0.14
307	0.17
308	0.19
309	0.19
310	0.2
311	0.23
312	0.23
313	0.22
314	0.26
315	0.31
316	0.32
317	0.35
318	0.35
319	0.33
320	0.31
321	0.32
322	0.28
323	0.23
324	0.26
325	0.25
326	0.25
327	0.26
328	0.26
329	0.28
330	0.29
331	0.29
332	0.22
333	0.23
334	0.22
335	0.19
336	0.15
337	0.11
338	0.1
339	0.08
340	0.08
341	0.05
342	0.05
343	0.04
344	0.04
345	0.04
346	0.03
347	0.03
348	0.03
349	0.02
350	0.03
351	0.03
352	0.03
353	0.02
354	0.02
355	0.03
356	0.03
357	0.03
358	0.03
359	0.03
360	0.04
361	0.04
362	0.04
363	0.05
364	0.05
365	0.06
366	0.07
367	0.08
368	0.07
369	0.07
370	0.07
371	0.07
372	0.07
373	0.09
374	0.08
375	0.08
376	0.07
377	0.08
378	0.08
379	0.08
380	0.09
381	0.07
382	0.08
383	0.1
384	0.14
385	0.16
386	0.18
387	0.2
388	0.18
389	0.18
390	0.18
391	0.17
392	0.2
393	0.2
394	0.2
395	0.2
396	0.24
397	0.28
398	0.35
399	0.37
400	0.39
401	0.41
402	0.48
403	0.53
404	0.56
405	0.62
406	0.59
407	0.65
408	0.6
409	0.59
410	0.54
411	0.51
412	0.52
413	0.44
414	0.4
415	0.31
416	0.27
417	0.26
418	0.23
419	0.24
420	0.24
421	0.27
422	0.27
423	0.28
424	0.31
425	0.29
426	0.3
427	0.26
428	0.21
429	0.2
430	0.21
431	0.22
432	0.21
433	0.2
434	0.2
435	0.2
436	0.19
437	0.15
438	0.14
439	0.14
440	0.14
441	0.17
442	0.16
443	0.18
444	0.18
445	0.18
446	0.23
447	0.23
448	0.25
449	0.25
450	0.25
451	0.23
452	0.3
453	0.32
454	0.28
455	0.33
456	0.35
457	0.39
458	0.47
459	0.5
460	0.52
461	0.56
462	0.65
463	0.65
464	0.65
465	0.69
466	0.7
467	0.72
468	0.66
469	0.65
470	0.59
471	0.57
472	0.59

P40034

3D AlphaFold-predicted Structure Viewer