Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1TJ67

Protein Details
Accession A0A0A1TJ67    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
356-377DEDPKPSAEKKKQEEAKKSLEFAcidic
NLS Segment(s)
Subcellular Location(s) mito 25, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008728  Elongator_complex_protein_4  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0033588  C:elongator holoenzyme complex  
GO:0005634  C:nucleus  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF05625  PAXNEB  
CDD cd19494  Elp4  
Amino Acid Sequences MSFRKRGVVIGTPKPAQGAPVKAVIPNGARPSPLDGRLTTSTGTSSLDQLLAGHSGMPLGTTLLIEENGTTDFGGTLIRYFAAEGLVQGHAVHVLGCDDSWRRELPGLGSAGNEKTTKNESASDSKMKIAWRYETLGNRSVPNRDQPLPSTAAEDSQAFCHTFNLSKRLEAKDIKGQLSGYPVGPFMGQASSSPFKMFVAKLSASLETTPPSTVHRVAIPNLLSPTVYTSLACHPQEVLQLLHALRGLSRRFATKLVIMITLPVSLYPRAAGLTRWIELLNDGVLELVPLQQRPHLEKDPKKEDKAQGMLKVHSLPIFHEKGGGMDESWRREDLSFKLSASSGLIITPYSLPPIEDEDPKPSAEKKKQEEAKKSLEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.37
4 0.35
5 0.32
6 0.27
7 0.31
8 0.31
9 0.3
10 0.31
11 0.31
12 0.28
13 0.29
14 0.32
15 0.28
16 0.28
17 0.28
18 0.34
19 0.35
20 0.36
21 0.34
22 0.29
23 0.34
24 0.36
25 0.37
26 0.3
27 0.25
28 0.22
29 0.2
30 0.21
31 0.16
32 0.15
33 0.14
34 0.14
35 0.13
36 0.12
37 0.12
38 0.11
39 0.1
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.07
53 0.06
54 0.07
55 0.07
56 0.08
57 0.07
58 0.06
59 0.06
60 0.06
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.06
79 0.06
80 0.04
81 0.05
82 0.05
83 0.05
84 0.07
85 0.09
86 0.11
87 0.13
88 0.14
89 0.14
90 0.16
91 0.17
92 0.17
93 0.2
94 0.19
95 0.17
96 0.17
97 0.17
98 0.17
99 0.18
100 0.16
101 0.12
102 0.14
103 0.18
104 0.19
105 0.19
106 0.21
107 0.23
108 0.28
109 0.33
110 0.34
111 0.32
112 0.31
113 0.32
114 0.3
115 0.3
116 0.27
117 0.26
118 0.24
119 0.26
120 0.3
121 0.32
122 0.35
123 0.36
124 0.34
125 0.33
126 0.33
127 0.33
128 0.3
129 0.31
130 0.32
131 0.29
132 0.3
133 0.29
134 0.31
135 0.31
136 0.29
137 0.26
138 0.2
139 0.18
140 0.17
141 0.16
142 0.13
143 0.11
144 0.12
145 0.1
146 0.1
147 0.1
148 0.1
149 0.13
150 0.15
151 0.2
152 0.19
153 0.21
154 0.25
155 0.27
156 0.31
157 0.29
158 0.3
159 0.31
160 0.35
161 0.33
162 0.3
163 0.27
164 0.23
165 0.23
166 0.21
167 0.15
168 0.11
169 0.1
170 0.1
171 0.09
172 0.08
173 0.06
174 0.06
175 0.05
176 0.05
177 0.09
178 0.1
179 0.11
180 0.11
181 0.1
182 0.1
183 0.13
184 0.12
185 0.1
186 0.13
187 0.13
188 0.14
189 0.15
190 0.15
191 0.13
192 0.14
193 0.13
194 0.09
195 0.1
196 0.09
197 0.09
198 0.1
199 0.13
200 0.13
201 0.13
202 0.16
203 0.17
204 0.17
205 0.21
206 0.19
207 0.18
208 0.18
209 0.17
210 0.13
211 0.12
212 0.13
213 0.11
214 0.11
215 0.09
216 0.1
217 0.13
218 0.2
219 0.2
220 0.17
221 0.16
222 0.17
223 0.19
224 0.19
225 0.16
226 0.1
227 0.13
228 0.13
229 0.13
230 0.12
231 0.1
232 0.1
233 0.14
234 0.15
235 0.15
236 0.16
237 0.18
238 0.19
239 0.21
240 0.22
241 0.19
242 0.21
243 0.19
244 0.19
245 0.16
246 0.16
247 0.14
248 0.13
249 0.1
250 0.08
251 0.08
252 0.08
253 0.08
254 0.07
255 0.07
256 0.08
257 0.09
258 0.09
259 0.13
260 0.15
261 0.16
262 0.16
263 0.16
264 0.15
265 0.15
266 0.16
267 0.1
268 0.07
269 0.06
270 0.05
271 0.05
272 0.05
273 0.05
274 0.07
275 0.08
276 0.09
277 0.1
278 0.13
279 0.16
280 0.21
281 0.28
282 0.34
283 0.42
284 0.48
285 0.58
286 0.66
287 0.71
288 0.71
289 0.72
290 0.7
291 0.69
292 0.7
293 0.66
294 0.62
295 0.59
296 0.55
297 0.49
298 0.44
299 0.36
300 0.3
301 0.25
302 0.2
303 0.24
304 0.26
305 0.23
306 0.24
307 0.22
308 0.22
309 0.23
310 0.21
311 0.13
312 0.18
313 0.22
314 0.24
315 0.26
316 0.26
317 0.25
318 0.25
319 0.29
320 0.27
321 0.27
322 0.25
323 0.23
324 0.25
325 0.23
326 0.23
327 0.21
328 0.18
329 0.13
330 0.11
331 0.11
332 0.09
333 0.11
334 0.12
335 0.11
336 0.12
337 0.12
338 0.12
339 0.13
340 0.2
341 0.22
342 0.26
343 0.28
344 0.31
345 0.32
346 0.33
347 0.34
348 0.34
349 0.42
350 0.45
351 0.53
352 0.55
353 0.64
354 0.72
355 0.79
356 0.83
357 0.8