Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P26786

Protein Details
Accession P26786    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-119LPKPSRTSRQVQKRPRSRTLTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.833, nucl 10, mito_nucl 5.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0032040  C:small-subunit processome  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042274  P:ribosomal small subunit biogenesis  
GO:0042254  P:ribosome biogenesis  
GO:0006364  P:rRNA processing  
KEGG sce:YOR096W  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSAPQAKILSQAPTELELQVAQAFVELENSSPELKAELRPLQFKSIREIDVAGGKKALAIFVPVPSLAGFHKVQTKLTRELEKKFQDRHVIFLAERRILPKPSRTSRQVQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPSETH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.17
4 0.13
5 0.13
6 0.12
7 0.1
8 0.08
9 0.07
10 0.07
11 0.06
12 0.08
13 0.07
14 0.07
15 0.09
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.11
22 0.14
23 0.18
24 0.23
25 0.26
26 0.31
27 0.33
28 0.39
29 0.42
30 0.4
31 0.41
32 0.39
33 0.37
34 0.33
35 0.32
36 0.25
37 0.28
38 0.28
39 0.21
40 0.17
41 0.16
42 0.16
43 0.15
44 0.13
45 0.07
46 0.08
47 0.08
48 0.08
49 0.09
50 0.08
51 0.08
52 0.08
53 0.09
54 0.07
55 0.1
56 0.1
57 0.11
58 0.17
59 0.17
60 0.21
61 0.25
62 0.29
63 0.31
64 0.35
65 0.42
66 0.39
67 0.42
68 0.48
69 0.5
70 0.51
71 0.48
72 0.47
73 0.48
74 0.45
75 0.45
76 0.39
77 0.33
78 0.28
79 0.29
80 0.27
81 0.19
82 0.19
83 0.18
84 0.17
85 0.19
86 0.21
87 0.24
88 0.3
89 0.35
90 0.41
91 0.43
92 0.49
93 0.56
94 0.65
95 0.68
96 0.7
97 0.74
98 0.77
99 0.81
100 0.82
101 0.8
102 0.71
103 0.69
104 0.64
105 0.64
106 0.6
107 0.54
108 0.46
109 0.4
110 0.38
111 0.3
112 0.26
113 0.16
114 0.1
115 0.09
116 0.09
117 0.08
118 0.08
119 0.07
120 0.1
121 0.11
122 0.13
123 0.16
124 0.15
125 0.17
126 0.18
127 0.18
128 0.15
129 0.19
130 0.24
131 0.3
132 0.36
133 0.38
134 0.39
135 0.39
136 0.38
137 0.35
138 0.31
139 0.28
140 0.24
141 0.27
142 0.25
143 0.28
144 0.35
145 0.35
146 0.31
147 0.3
148 0.29
149 0.27
150 0.28
151 0.25
152 0.19
153 0.2
154 0.2
155 0.16
156 0.19
157 0.2
158 0.2
159 0.2
160 0.23
161 0.25
162 0.26
163 0.29
164 0.28
165 0.23
166 0.23
167 0.24
168 0.25
169 0.25
170 0.23