Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TT37

Protein Details
Accession A0A0A1TT37    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MVKKRKNNGRNKKGRGHVNPIRCBasic
81-112GKIVRVRSRDGRRNRAPPPRVRYNKDGKKITPBasic
NLS Segment(s)
PositionSequence
3-16KKRKNNGRNKKGRG
85-116RVRSRDGRRNRAPPPRVRYNKDGKKITPTAPK
Subcellular Location(s) mito 11.5, mito_nucl 10, cyto 8, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVNPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSRDGRRNRAPPPRVRYNKDGKKITPTAPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.83
4 0.8
5 0.79
6 0.78
7 0.75
8 0.71
9 0.63
10 0.6
11 0.56
12 0.55
13 0.54
14 0.53
15 0.53
16 0.57
17 0.61
18 0.65
19 0.69
20 0.7
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.67
27 0.67
28 0.59
29 0.51
30 0.45
31 0.36
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.05
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.11
55 0.17
56 0.19
57 0.21
58 0.23
59 0.24
60 0.25
61 0.28
62 0.25
63 0.2
64 0.2
65 0.19
66 0.2
67 0.2
68 0.22
69 0.23
70 0.29
71 0.32
72 0.33
73 0.36
74 0.41
75 0.5
76 0.56
77 0.62
78 0.66
79 0.7
80 0.76
81 0.81
82 0.82
83 0.81
84 0.81
85 0.8
86 0.81
87 0.81
88 0.79
89 0.79
90 0.8
91 0.81
92 0.81
93 0.8
94 0.72
95 0.73
96 0.71
97 0.7