Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1T7L3

Protein Details
Accession A0A0A1T7L3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-68VYTNKWLTARRERRERKAVAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, mito 6, E.R. 5, cyto_pero 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAIITFEKDAVMSQLLKRDDDRNWAAKNVGPMVVFCIVFVVALLVIGVYTNKWLTARRERRERKAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.19
3 0.2
4 0.21
5 0.23
6 0.25
7 0.25
8 0.3
9 0.33
10 0.33
11 0.33
12 0.33
13 0.31
14 0.29
15 0.29
16 0.23
17 0.2
18 0.14
19 0.12
20 0.13
21 0.14
22 0.12
23 0.1
24 0.09
25 0.07
26 0.07
27 0.07
28 0.04
29 0.03
30 0.03
31 0.03
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.04
38 0.05
39 0.06
40 0.07
41 0.12
42 0.2
43 0.31
44 0.41
45 0.5
46 0.61
47 0.7
48 0.79