Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TP43

Protein Details
Accession A0A0A1TP43   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
505-528QPKVPGLTKLPKLRKLPKLPKLDFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, nucl 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
IPR041792  MPP_PAP  
IPR039331  PPA-like  
IPR008963  Purple_acid_Pase-like_N  
IPR015914  Purple_acid_Pase_N  
IPR025733  Purple_acid_PPase_C_dom  
Gene Ontology GO:0003993  F:acid phosphatase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00149  Metallophos  
PF14008  Metallophos_C  
PF16656  Pur_ac_phosph_N  
CDD cd00839  MPP_PAPs  
Amino Acid Sequences MLLSKQLASFIAFAGLSSNAVLGMMNETVNSQVRLAYATDSGMIVSWNTLKQLSQPTVRYGRSADDLCFQASSSVSITYNTSLTYHNHVALKGLRPDTTYYYLPSDMLADNATTPPYSFRTSRSAGDGTPYSAAVLIDLGTMGPKGLTTSAGQTVNPNNILKPGENNTMQSLEKLISTYDFMLHPGDFAYADAWLKEEAQGFLPNTTLQEGYEVYESILNDFYDEMTPMSSTKPWMVGAGNHEANCICGTYKDPFNHITYNDTICSPGQDNFTDFRTRFRMPAESSGGTENFWYSFDHGMVHYVMLDTETDLGNGVIGPDETNGGEGDHTGPFGAYPNAQLDWLEKDLQSVDRTKTPWVIASGHRPWYLSYANKTHTICWSCKNNFEPLFIKYGVDLYLSGHAHFYQRSAPLNNGTIDPNELDNPSAPWYITSGAAGHYDGLDNGTAVPKPYERFRMDQRNATYGWSRLTFHNCTHMTHDWINSNDSSIVDSATLYKKRECSLSQPKVPGLTKLPKLRKLPKLPKLDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.09
6 0.06
7 0.07
8 0.07
9 0.05
10 0.07
11 0.08
12 0.08
13 0.08
14 0.08
15 0.11
16 0.14
17 0.14
18 0.12
19 0.12
20 0.13
21 0.14
22 0.15
23 0.14
24 0.13
25 0.12
26 0.13
27 0.12
28 0.11
29 0.1
30 0.09
31 0.07
32 0.08
33 0.1
34 0.1
35 0.12
36 0.12
37 0.12
38 0.17
39 0.26
40 0.3
41 0.34
42 0.36
43 0.42
44 0.49
45 0.5
46 0.46
47 0.4
48 0.38
49 0.37
50 0.36
51 0.31
52 0.28
53 0.28
54 0.27
55 0.25
56 0.22
57 0.17
58 0.15
59 0.15
60 0.12
61 0.12
62 0.12
63 0.13
64 0.14
65 0.14
66 0.14
67 0.13
68 0.13
69 0.14
70 0.16
71 0.22
72 0.23
73 0.25
74 0.27
75 0.26
76 0.29
77 0.31
78 0.35
79 0.34
80 0.34
81 0.3
82 0.3
83 0.33
84 0.35
85 0.35
86 0.3
87 0.26
88 0.27
89 0.27
90 0.25
91 0.22
92 0.19
93 0.15
94 0.14
95 0.12
96 0.09
97 0.1
98 0.1
99 0.11
100 0.08
101 0.09
102 0.11
103 0.13
104 0.17
105 0.17
106 0.2
107 0.26
108 0.29
109 0.31
110 0.33
111 0.32
112 0.28
113 0.31
114 0.29
115 0.24
116 0.22
117 0.2
118 0.14
119 0.13
120 0.13
121 0.08
122 0.07
123 0.06
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.04
133 0.05
134 0.06
135 0.07
136 0.1
137 0.14
138 0.15
139 0.16
140 0.18
141 0.21
142 0.22
143 0.25
144 0.22
145 0.18
146 0.2
147 0.22
148 0.19
149 0.2
150 0.22
151 0.24
152 0.25
153 0.26
154 0.25
155 0.26
156 0.25
157 0.21
158 0.18
159 0.13
160 0.12
161 0.11
162 0.1
163 0.07
164 0.09
165 0.09
166 0.09
167 0.09
168 0.09
169 0.1
170 0.1
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.08
184 0.09
185 0.09
186 0.1
187 0.13
188 0.13
189 0.13
190 0.13
191 0.11
192 0.11
193 0.11
194 0.1
195 0.07
196 0.08
197 0.08
198 0.08
199 0.09
200 0.08
201 0.07
202 0.09
203 0.09
204 0.09
205 0.09
206 0.08
207 0.08
208 0.08
209 0.08
210 0.07
211 0.07
212 0.06
213 0.05
214 0.06
215 0.06
216 0.07
217 0.07
218 0.08
219 0.08
220 0.09
221 0.09
222 0.1
223 0.1
224 0.11
225 0.14
226 0.18
227 0.19
228 0.18
229 0.18
230 0.16
231 0.16
232 0.14
233 0.12
234 0.06
235 0.05
236 0.07
237 0.1
238 0.15
239 0.16
240 0.18
241 0.2
242 0.22
243 0.24
244 0.22
245 0.22
246 0.19
247 0.2
248 0.18
249 0.16
250 0.14
251 0.12
252 0.13
253 0.11
254 0.11
255 0.12
256 0.12
257 0.13
258 0.14
259 0.16
260 0.19
261 0.18
262 0.19
263 0.22
264 0.22
265 0.22
266 0.23
267 0.26
268 0.24
269 0.29
270 0.3
271 0.26
272 0.26
273 0.26
274 0.24
275 0.19
276 0.17
277 0.12
278 0.08
279 0.08
280 0.08
281 0.08
282 0.08
283 0.08
284 0.09
285 0.09
286 0.1
287 0.09
288 0.09
289 0.07
290 0.06
291 0.06
292 0.05
293 0.05
294 0.04
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.04
301 0.04
302 0.04
303 0.03
304 0.03
305 0.04
306 0.04
307 0.04
308 0.04
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.07
315 0.06
316 0.06
317 0.06
318 0.05
319 0.05
320 0.07
321 0.07
322 0.06
323 0.07
324 0.09
325 0.09
326 0.09
327 0.09
328 0.09
329 0.12
330 0.13
331 0.13
332 0.12
333 0.12
334 0.13
335 0.15
336 0.16
337 0.17
338 0.18
339 0.2
340 0.21
341 0.23
342 0.24
343 0.23
344 0.23
345 0.22
346 0.23
347 0.22
348 0.3
349 0.32
350 0.34
351 0.34
352 0.32
353 0.3
354 0.31
355 0.32
356 0.28
357 0.29
358 0.29
359 0.31
360 0.37
361 0.37
362 0.35
363 0.38
364 0.38
365 0.35
366 0.37
367 0.44
368 0.4
369 0.45
370 0.46
371 0.47
372 0.45
373 0.47
374 0.42
375 0.35
376 0.37
377 0.32
378 0.29
379 0.21
380 0.2
381 0.16
382 0.14
383 0.12
384 0.08
385 0.14
386 0.14
387 0.14
388 0.14
389 0.14
390 0.15
391 0.16
392 0.16
393 0.14
394 0.17
395 0.22
396 0.23
397 0.25
398 0.27
399 0.3
400 0.29
401 0.27
402 0.25
403 0.21
404 0.2
405 0.19
406 0.16
407 0.15
408 0.14
409 0.14
410 0.13
411 0.14
412 0.15
413 0.15
414 0.13
415 0.12
416 0.13
417 0.14
418 0.13
419 0.13
420 0.1
421 0.1
422 0.12
423 0.11
424 0.1
425 0.09
426 0.09
427 0.08
428 0.09
429 0.08
430 0.07
431 0.07
432 0.09
433 0.09
434 0.1
435 0.12
436 0.14
437 0.17
438 0.22
439 0.3
440 0.33
441 0.38
442 0.47
443 0.56
444 0.59
445 0.64
446 0.63
447 0.59
448 0.55
449 0.53
450 0.47
451 0.38
452 0.36
453 0.3
454 0.28
455 0.29
456 0.36
457 0.35
458 0.34
459 0.41
460 0.38
461 0.38
462 0.43
463 0.42
464 0.41
465 0.4
466 0.43
467 0.39
468 0.39
469 0.4
470 0.34
471 0.32
472 0.27
473 0.24
474 0.21
475 0.16
476 0.15
477 0.11
478 0.11
479 0.14
480 0.21
481 0.25
482 0.26
483 0.3
484 0.34
485 0.37
486 0.43
487 0.42
488 0.45
489 0.52
490 0.59
491 0.62
492 0.63
493 0.63
494 0.65
495 0.63
496 0.57
497 0.54
498 0.53
499 0.54
500 0.6
501 0.66
502 0.66
503 0.75
504 0.79
505 0.81
506 0.84
507 0.86
508 0.85