Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1TJ49

Protein Details
Accession A0A0A1TJ49    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
54-78IQSENRAKAKERRDRIKRQQEEAGFHydrophilic
NLS Segment(s)
PositionSequence
59-70RAKAKERRDRIK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPHLHTKNAIACEEIIAALEACHNQGFMHKATGGCNDIKEKVNQCLRAERTKIQSENRAKAKERRDRIKRQQEEAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.12
4 0.08
5 0.08
6 0.06
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.08
14 0.11
15 0.11
16 0.12
17 0.13
18 0.13
19 0.15
20 0.17
21 0.17
22 0.15
23 0.15
24 0.15
25 0.16
26 0.17
27 0.19
28 0.19
29 0.24
30 0.28
31 0.31
32 0.31
33 0.36
34 0.39
35 0.43
36 0.45
37 0.42
38 0.44
39 0.47
40 0.5
41 0.47
42 0.53
43 0.54
44 0.59
45 0.62
46 0.61
47 0.59
48 0.62
49 0.68
50 0.68
51 0.7
52 0.72
53 0.75
54 0.8
55 0.87
56 0.9
57 0.88
58 0.84