Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P26793

Protein Details
Accession P26793    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
357-382LAAAAKRAQENKKLNKNKNKVTKGRRHydrophilic
NLS Segment(s)
PositionSequence
361-382AKRAQENKKLNKNKNKVTKGRR
Subcellular Location(s) nucl 14, mito_nucl 11.666, cyto_mito 7.666, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036279  5-3_exonuclease_C_sf  
IPR023426  Flap_endonuc  
IPR008918  HhH2  
IPR029060  PIN-like_dom_sf  
IPR006086  XPG-I_dom  
IPR006084  XPG/Rad2  
IPR019974  XPG_CS  
IPR006085  XPG_DNA_repair_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0005739  C:mitochondrion  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0005634  C:nucleus  
GO:0008409  F:5'-3' exonuclease activity  
GO:0017108  F:5'-flap endonuclease activity  
GO:0003677  F:DNA binding  
GO:0000287  F:magnesium ion binding  
GO:0006284  P:base-excision repair  
GO:0043137  P:DNA replication, removal of RNA primer  
GO:0006303  P:double-strand break repair via nonhomologous end joining  
GO:0007534  P:gene conversion at mating-type locus  
GO:0035753  P:maintenance of DNA trinucleotide repeats  
KEGG sce:YKL113C  -  
Pfam View protein in Pfam  
PF00867  XPG_I  
PF00752  XPG_N  
PROSITE View protein in PROSITE  
PS00841  XPG_1  
PS00842  XPG_2  
CDD cd09907  H3TH_FEN1-Euk  
cd09867  PIN_FEN1  
Amino Acid Sequences MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVGPVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDGNEINLKWSPPKEKELIEYLCDDKKFSEERVKSGISRLKKGLKSGIQGRLDGFFQVVPKTKEQLAAAAKRAQENKKLNKNKNKVTKGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.18
4 0.21
5 0.23
6 0.25
7 0.29
8 0.37
9 0.4
10 0.44
11 0.47
12 0.49
13 0.51
14 0.53
15 0.51
16 0.42
17 0.43
18 0.4
19 0.34
20 0.28
21 0.23
22 0.23
23 0.25
24 0.24
25 0.19
26 0.17
27 0.15
28 0.15
29 0.14
30 0.12
31 0.1
32 0.12
33 0.13
34 0.15
35 0.15
36 0.18
37 0.19
38 0.18
39 0.17
40 0.16
41 0.15
42 0.14
43 0.14
44 0.11
45 0.09
46 0.08
47 0.09
48 0.11
49 0.11
50 0.1
51 0.1
52 0.1
53 0.11
54 0.13
55 0.14
56 0.11
57 0.13
58 0.13
59 0.14
60 0.15
61 0.16
62 0.17
63 0.21
64 0.28
65 0.32
66 0.33
67 0.32
68 0.31
69 0.29
70 0.31
71 0.27
72 0.19
73 0.22
74 0.3
75 0.32
76 0.38
77 0.39
78 0.38
79 0.38
80 0.41
81 0.38
82 0.39
83 0.44
84 0.42
85 0.45
86 0.51
87 0.58
88 0.61
89 0.64
90 0.58
91 0.59
92 0.64
93 0.7
94 0.67
95 0.67
96 0.63
97 0.58
98 0.55
99 0.46
100 0.37
101 0.29
102 0.24
103 0.18
104 0.18
105 0.17
106 0.17
107 0.19
108 0.22
109 0.27
110 0.3
111 0.33
112 0.37
113 0.43
114 0.51
115 0.53
116 0.56
117 0.58
118 0.6
119 0.61
120 0.6
121 0.56
122 0.53
123 0.54
124 0.48
125 0.42
126 0.35
127 0.27
128 0.21
129 0.19
130 0.14
131 0.09
132 0.07
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.04
142 0.1
143 0.1
144 0.11
145 0.11
146 0.11
147 0.12
148 0.13
149 0.12
150 0.09
151 0.11
152 0.12
153 0.13
154 0.13
155 0.13
156 0.15
157 0.16
158 0.15
159 0.16
160 0.16
161 0.16
162 0.16
163 0.15
164 0.12
165 0.12
166 0.09
167 0.07
168 0.07
169 0.07
170 0.06
171 0.07
172 0.09
173 0.09
174 0.13
175 0.22
176 0.21
177 0.24
178 0.25
179 0.28
180 0.29
181 0.29
182 0.32
183 0.24
184 0.25
185 0.23
186 0.24
187 0.22
188 0.22
189 0.23
190 0.16
191 0.17
192 0.16
193 0.15
194 0.14
195 0.12
196 0.09
197 0.07
198 0.06
199 0.05
200 0.04
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.03
213 0.03
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.04
220 0.06
221 0.06
222 0.07
223 0.07
224 0.08
225 0.08
226 0.08
227 0.09
228 0.09
229 0.09
230 0.11
231 0.1
232 0.1
233 0.1
234 0.11
235 0.12
236 0.12
237 0.15
238 0.16
239 0.19
240 0.2
241 0.2
242 0.21
243 0.19
244 0.18
245 0.15
246 0.11
247 0.08
248 0.09
249 0.08
250 0.08
251 0.1
252 0.11
253 0.11
254 0.17
255 0.18
256 0.17
257 0.18
258 0.21
259 0.23
260 0.27
261 0.37
262 0.39
263 0.43
264 0.48
265 0.52
266 0.51
267 0.49
268 0.47
269 0.4
270 0.38
271 0.35
272 0.3
273 0.25
274 0.27
275 0.24
276 0.23
277 0.2
278 0.14
279 0.12
280 0.11
281 0.11
282 0.1
283 0.1
284 0.11
285 0.11
286 0.12
287 0.16
288 0.21
289 0.28
290 0.3
291 0.36
292 0.38
293 0.39
294 0.43
295 0.46
296 0.44
297 0.38
298 0.37
299 0.34
300 0.35
301 0.33
302 0.29
303 0.22
304 0.25
305 0.25
306 0.27
307 0.34
308 0.32
309 0.36
310 0.41
311 0.44
312 0.39
313 0.45
314 0.47
315 0.42
316 0.46
317 0.49
318 0.52
319 0.52
320 0.56
321 0.57
322 0.55
323 0.58
324 0.6
325 0.62
326 0.56
327 0.54
328 0.51
329 0.44
330 0.39
331 0.31
332 0.23
333 0.15
334 0.15
335 0.18
336 0.23
337 0.25
338 0.27
339 0.31
340 0.32
341 0.35
342 0.34
343 0.37
344 0.39
345 0.42
346 0.43
347 0.45
348 0.45
349 0.47
350 0.55
351 0.53
352 0.54
353 0.58
354 0.64
355 0.7
356 0.79
357 0.83
358 0.86
359 0.9
360 0.91
361 0.92
362 0.92