Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1T4E8

Protein Details
Accession A0A0A1T4E8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-100EQQMRLQRRVQREKDRWARYEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_mito 10, mito 8.5, pero 4, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038882  Rcf3  
Amino Acid Sequences MGFRDKVLNEEADRASKEAVKGGFIGALKWGAGAAILGAIGYTMSPVYRATTVQFKVYLQMSGMVLGGMIEADWRLRQFEQQMRLQRRVQREKDRWARYEEEYGKGDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.23
4 0.22
5 0.22
6 0.21
7 0.18
8 0.17
9 0.16
10 0.17
11 0.15
12 0.14
13 0.1
14 0.1
15 0.09
16 0.08
17 0.08
18 0.05
19 0.04
20 0.04
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.04
34 0.05
35 0.06
36 0.07
37 0.08
38 0.14
39 0.15
40 0.15
41 0.16
42 0.15
43 0.16
44 0.16
45 0.15
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.06
52 0.05
53 0.05
54 0.04
55 0.03
56 0.02
57 0.02
58 0.02
59 0.03
60 0.04
61 0.05
62 0.07
63 0.08
64 0.11
65 0.18
66 0.24
67 0.3
68 0.36
69 0.46
70 0.5
71 0.55
72 0.59
73 0.58
74 0.63
75 0.67
76 0.7
77 0.71
78 0.73
79 0.78
80 0.82
81 0.84
82 0.77
83 0.73
84 0.68
85 0.61
86 0.64
87 0.57
88 0.52