Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TD37

Protein Details
Accession A0A0A1TD37    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-28APPPTRPKGKNRLKARTVQKRREIVHydrophilic
NLS Segment(s)
PositionSequence
8-25TRPKGKNRLKARTVQKRR
Subcellular Location(s) mito_nucl 12.333, nucl 11.5, mito 11, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MVGAPPPTRPKGKNRLKARTVQKRREIVPKFWTEPMGDTINFIDWNSLKTTDPENARIVDCRHVASFNWLNKKTPTIVIPGMPRAWTPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.78
4 0.83
5 0.84
6 0.84
7 0.84
8 0.83
9 0.82
10 0.78
11 0.76
12 0.77
13 0.72
14 0.66
15 0.64
16 0.6
17 0.54
18 0.5
19 0.47
20 0.37
21 0.33
22 0.31
23 0.25
24 0.19
25 0.16
26 0.15
27 0.14
28 0.13
29 0.11
30 0.09
31 0.07
32 0.08
33 0.09
34 0.1
35 0.09
36 0.11
37 0.13
38 0.16
39 0.18
40 0.2
41 0.2
42 0.21
43 0.21
44 0.22
45 0.22
46 0.22
47 0.21
48 0.19
49 0.18
50 0.18
51 0.18
52 0.23
53 0.29
54 0.31
55 0.39
56 0.39
57 0.41
58 0.41
59 0.44
60 0.39
61 0.35
62 0.31
63 0.28
64 0.29
65 0.31
66 0.33
67 0.34
68 0.33
69 0.3
70 0.28