FuNGI

A0A0A1TTB5

Protein Details

Accession

A0A0A1TTB5

Localization Confidence

Low

Confidence Score

9.9

NoLS Segment(s)

Position	Sequence	Protein Nature
60-91	FPTSPVQQVKKQPQPQKQQQSQRKKSGRMSGI	Hydrophilic

NLS Segment(s)

Position	Sequence
278-280	KKR

Subcellular Location(s)

mito 11.5, mito_nucl 9.5, cyto 7, nucl 6.5

Family & Domain DBs

InterPro	View protein in InterPro IPR016181 Acyl_CoA_acyltransferase IPR002717 HAT_MYST-type IPR036388 WH-like_DNA-bd_sf IPR040706 Zf-MYST
Gene Ontology	GO:0005694 C:chromosome GO:0004402 F:histone acetyltransferase activity GO:0016573 P:histone acetylation GO:0006355 P:regulation of DNA-templated transcription
Pfam	View protein in Pfam PF01853 MOZ_SAS PF17772 zf-MYST
PROSITE	View protein in PROSITE PS51726 MYST_HAT

Amino Acid Sequences

MQQKRKRGDGNLSPSPDPARKAAAAAAVRPTRQTPVYPPPIPTHSPPKLVSATPVPLPVFPTSPVQQVKKQPQPQKQQQSQRKKSGRMSGIVATSGGFGKENIRPAAEEETPPQFGKQVQQQQQLLQQPQQQQQQRLPATRVERMIPPSVTPVPAPKPPVVEKKLSADRNIDMVVLGNLCFKTWYPSYYGKEVLGDTSGNSARGAKDYDAKHHKKGETAMLDRLYVCPHCFKYAKEIVTWWGHLRACEQKGTIPGRKIYTHPRGVRKVLVAQERPGVKKRRGEGVRYVEEVVRDEGEWSVWEADGEVDGLFCQNLSLFAKLFLDNKSVFFDVTGFNYLLLVYTPPVTASTPTPIPQVTGFFSKEKMSWDNNNLACILVFPPWQRKGLGALLMGVSYEISQREGILGGPEKPISDLGKKGYRRFWTGEIARWLLELDVTTDSETIIDVDDVSRGTWIFGDDCLGVLREMGIMEDGGIGAGKAVPVEPQDEDEDQEQTEQEPKPVKTMPRVRVDKEAIRRHVALHRINLEKVCDPDGFAEGYALPEVDEDEEEAEEEDEDADEQDE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.59
3	0.52
4	0.45
5	0.38
6	0.35
7	0.31
8	0.31
9	0.31
10	0.32
11	0.3
12	0.3
13	0.36
14	0.34
15	0.34
16	0.35
17	0.34
18	0.32
19	0.33
20	0.34
21	0.33
22	0.4
23	0.48
24	0.49
25	0.5
26	0.51
27	0.55
28	0.56
29	0.54
30	0.54
31	0.5
32	0.53
33	0.51
34	0.51
35	0.49
36	0.45
37	0.44
38	0.39
39	0.37
40	0.32
41	0.35
42	0.3
43	0.27
44	0.29
45	0.27
46	0.23
47	0.21
48	0.25
49	0.23
50	0.3
51	0.36
52	0.37
53	0.42
54	0.5
55	0.59
56	0.64
57	0.71
58	0.73
59	0.76
60	0.83
61	0.87
62	0.88
63	0.87
64	0.88
65	0.89
66	0.91
67	0.91
68	0.91
69	0.89
70	0.86
71	0.84
72	0.83
73	0.78
74	0.7
75	0.65
76	0.58
77	0.51
78	0.43
79	0.35
80	0.25
81	0.2
82	0.17
83	0.13
84	0.09
85	0.08
86	0.12
87	0.15
88	0.2
89	0.2
90	0.2
91	0.2
92	0.23
93	0.28
94	0.26
95	0.24
96	0.22
97	0.25
98	0.27
99	0.27
100	0.25
101	0.21
102	0.2
103	0.24
104	0.3
105	0.36
106	0.41
107	0.49
108	0.5
109	0.51
110	0.57
111	0.58
112	0.52
113	0.46
114	0.44
115	0.44
116	0.49
117	0.54
118	0.54
119	0.52
120	0.53
121	0.58
122	0.57
123	0.54
124	0.49
125	0.47
126	0.46
127	0.46
128	0.43
129	0.36
130	0.35
131	0.35
132	0.37
133	0.32
134	0.28
135	0.28
136	0.28
137	0.26
138	0.23
139	0.24
140	0.23
141	0.26
142	0.29
143	0.26
144	0.29
145	0.34
146	0.43
147	0.42
148	0.42
149	0.41
150	0.45
151	0.52
152	0.5
153	0.47
154	0.4
155	0.37
156	0.35
157	0.33
158	0.25
159	0.17
160	0.15
161	0.12
162	0.09
163	0.08
164	0.08
165	0.08
166	0.08
167	0.08
168	0.08
169	0.12
170	0.13
171	0.14
172	0.17
173	0.25
174	0.28
175	0.31
176	0.33
177	0.28
178	0.28
179	0.27
180	0.22
181	0.16
182	0.13
183	0.1
184	0.12
185	0.12
186	0.11
187	0.11
188	0.12
189	0.11
190	0.13
191	0.14
192	0.12
193	0.18
194	0.19
195	0.27
196	0.37
197	0.4
198	0.44
199	0.48
200	0.48
201	0.45
202	0.46
203	0.45
204	0.41
205	0.4
206	0.39
207	0.33
208	0.32
209	0.29
210	0.27
211	0.21
212	0.16
213	0.14
214	0.14
215	0.15
216	0.19
217	0.2
218	0.2
219	0.27
220	0.32
221	0.32
222	0.28
223	0.28
224	0.28
225	0.28
226	0.29
227	0.21
228	0.2
229	0.19
230	0.18
231	0.21
232	0.23
233	0.23
234	0.23
235	0.22
236	0.2
237	0.26
238	0.31
239	0.33
240	0.29
241	0.3
242	0.31
243	0.32
244	0.33
245	0.36
246	0.39
247	0.43
248	0.46
249	0.51
250	0.53
251	0.53
252	0.53
253	0.45
254	0.42
255	0.39
256	0.39
257	0.33
258	0.29
259	0.32
260	0.32
261	0.33
262	0.35
263	0.36
264	0.33
265	0.37
266	0.38
267	0.44
268	0.44
269	0.46
270	0.47
271	0.49
272	0.47
273	0.43
274	0.42
275	0.33
276	0.3
277	0.27
278	0.19
279	0.12
280	0.09
281	0.09
282	0.07
283	0.07
284	0.07
285	0.06
286	0.06
287	0.05
288	0.05
289	0.05
290	0.05
291	0.05
292	0.05
293	0.04
294	0.03
295	0.03
296	0.04
297	0.03
298	0.03
299	0.03
300	0.02
301	0.04
302	0.06
303	0.06
304	0.07
305	0.08
306	0.09
307	0.1
308	0.12
309	0.11
310	0.14
311	0.13
312	0.14
313	0.16
314	0.15
315	0.14
316	0.12
317	0.12
318	0.1
319	0.11
320	0.12
321	0.1
322	0.09
323	0.09
324	0.09
325	0.08
326	0.07
327	0.06
328	0.04
329	0.05
330	0.05
331	0.05
332	0.06
333	0.07
334	0.08
335	0.09
336	0.12
337	0.12
338	0.13
339	0.14
340	0.13
341	0.14
342	0.14
343	0.14
344	0.13
345	0.16
346	0.17
347	0.16
348	0.18
349	0.18
350	0.18
351	0.2
352	0.22
353	0.23
354	0.27
355	0.3
356	0.36
357	0.35
358	0.35
359	0.32
360	0.27
361	0.22
362	0.18
363	0.15
364	0.09
365	0.1
366	0.12
367	0.19
368	0.21
369	0.23
370	0.22
371	0.22
372	0.24
373	0.25
374	0.26
375	0.19
376	0.17
377	0.16
378	0.15
379	0.14
380	0.1
381	0.07
382	0.05
383	0.06
384	0.05
385	0.06
386	0.07
387	0.07
388	0.07
389	0.08
390	0.08
391	0.1
392	0.11
393	0.11
394	0.13
395	0.13
396	0.13
397	0.13
398	0.16
399	0.15
400	0.17
401	0.18
402	0.23
403	0.31
404	0.34
405	0.39
406	0.44
407	0.45
408	0.47
409	0.48
410	0.47
411	0.48
412	0.47
413	0.49
414	0.46
415	0.43
416	0.38
417	0.34
418	0.3
419	0.2
420	0.18
421	0.11
422	0.08
423	0.08
424	0.09
425	0.09
426	0.09
427	0.09
428	0.08
429	0.08
430	0.06
431	0.06
432	0.05
433	0.05
434	0.05
435	0.06
436	0.06
437	0.06
438	0.07
439	0.06
440	0.07
441	0.07
442	0.08
443	0.08
444	0.08
445	0.1
446	0.09
447	0.09
448	0.1
449	0.1
450	0.09
451	0.08
452	0.08
453	0.06
454	0.06
455	0.06
456	0.06
457	0.05
458	0.05
459	0.05
460	0.05
461	0.04
462	0.04
463	0.04
464	0.03
465	0.04
466	0.04
467	0.04
468	0.04
469	0.06
470	0.07
471	0.1
472	0.1
473	0.13
474	0.16
475	0.17
476	0.19
477	0.19
478	0.19
479	0.17
480	0.18
481	0.15
482	0.13
483	0.19
484	0.17
485	0.21
486	0.27
487	0.27
488	0.32
489	0.37
490	0.41
491	0.45
492	0.54
493	0.57
494	0.61
495	0.67
496	0.65
497	0.69
498	0.71
499	0.69
500	0.69
501	0.71
502	0.66
503	0.64
504	0.62
505	0.57
506	0.57
507	0.56
508	0.52
509	0.5
510	0.52
511	0.51
512	0.53
513	0.51
514	0.49
515	0.44
516	0.41
517	0.36
518	0.29
519	0.26
520	0.25
521	0.24
522	0.21
523	0.17
524	0.16
525	0.12
526	0.13
527	0.13
528	0.11
529	0.08
530	0.08
531	0.09
532	0.09
533	0.09
534	0.08
535	0.09
536	0.09
537	0.1
538	0.11
539	0.1
540	0.09
541	0.09
542	0.08
543	0.07
544	0.08

A0A0A1TTB5

3D AlphaFold-predicted Structure Viewer