Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P14063

Protein Details
Accession P14063    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRMSTHQKTRQRERLRNVDQVHydrophilic
64-85AMESKKKYKPRSKSLRLLNKPSHydrophilic
NLS Segment(s)
PositionSequence
69-76KKYKPRSK
110-127RKGIHKVPKWTKISIRKA
Subcellular Location(s) mito 21.5, cyto_mito 12.333, cyto_nucl 2.833, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sce:YKL138C  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKLTSPVAGGLLWKIPWRMSTHQKTRQRERLRNVDQVIKQLTLGLHVQRCQDKGLTYQEAMESKKKYKPRSKSLRLLNKPSVFPKENQMSSKDKYWTFDKKAVGYRKGIHKVPKWTKISIRKAPKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.14
5 0.13
6 0.14
7 0.17
8 0.22
9 0.27
10 0.36
11 0.45
12 0.53
13 0.62
14 0.71
15 0.77
16 0.81
17 0.85
18 0.85
19 0.84
20 0.82
21 0.83
22 0.8
23 0.78
24 0.71
25 0.69
26 0.59
27 0.55
28 0.49
29 0.38
30 0.32
31 0.26
32 0.22
33 0.16
34 0.17
35 0.15
36 0.15
37 0.16
38 0.2
39 0.2
40 0.21
41 0.2
42 0.2
43 0.17
44 0.19
45 0.22
46 0.21
47 0.19
48 0.18
49 0.19
50 0.2
51 0.21
52 0.21
53 0.19
54 0.2
55 0.25
56 0.31
57 0.39
58 0.46
59 0.53
60 0.6
61 0.68
62 0.74
63 0.77
64 0.81
65 0.83
66 0.81
67 0.79
68 0.77
69 0.69
70 0.63
71 0.59
72 0.56
73 0.47
74 0.41
75 0.42
76 0.41
77 0.41
78 0.4
79 0.41
80 0.39
81 0.4
82 0.44
83 0.41
84 0.35
85 0.35
86 0.4
87 0.44
88 0.45
89 0.48
90 0.46
91 0.47
92 0.54
93 0.59
94 0.56
95 0.52
96 0.53
97 0.57
98 0.6
99 0.6
100 0.6
101 0.59
102 0.66
103 0.71
104 0.74
105 0.69
106 0.68
107 0.73
108 0.74
109 0.77
110 0.76
111 0.78