Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q03790

Protein Details
Accession Q03790   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
447-470DLKKREQASKSKKSWLNRLNNWLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017389  Nucleoporin_NUP53  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR007846  RRM_NUP35_dom  
Gene Ontology GO:0005635  C:nuclear envelope  
GO:0031965  C:nuclear membrane  
GO:0005643  C:nuclear pore  
GO:0044613  C:nuclear pore central transport channel  
GO:0044615  C:nuclear pore nuclear basket  
GO:0042802  F:identical protein binding  
GO:0005543  F:phospholipid binding  
GO:0003697  F:single-stranded DNA binding  
GO:0017056  F:structural constituent of nuclear pore  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0051028  P:mRNA transport  
GO:0006607  P:NLS-bearing protein import into nucleus  
GO:0006999  P:nuclear pore organization  
GO:0006913  P:nucleocytoplasmic transport  
GO:0045893  P:positive regulation of DNA-templated transcription  
GO:0006606  P:protein import into nucleus  
GO:0034501  P:protein localization to kinetochore  
GO:0007088  P:regulation of mitotic nuclear division  
GO:0060188  P:regulation of protein desumoylation  
GO:0072417  P:response to spindle checkpoint signaling  
KEGG sce:YMR153W  -  
Pfam View protein in Pfam  
PF05172  Nup35_RRM  
PROSITE View protein in PROSITE  
PS51472  RRM_NUP35  
CDD cd12721  RRM_Nup53p_fungi  
Amino Acid Sequences MADLQKQENSSRFTNVSVIAPESQGQHEQQKQQEQLEQQKQPTGLLKGLNGFPSAPQPLFMEDPPSTVSGELNDNPAWFNNPRKRAIPNSIIKRSNGQSLSPVRSDSADVPAFSNSNGFNNVTFGSKKDPRILKNVSPNDNNSANNNAHSSDLGTVVFDSNEAPPKTSLADWQKEDGIFSSKTDNIEDPNLSSNITFDGKPTATPSPFRPLEKTSRILNFFDKNTKTTPNTASSEASAGSKEGASTNWDDHAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSLTAQKYPIYTGDGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSPAALKQLASLKKSEEIINNKTSSQTSLSSKDLSNYRKTEGIFEKAKAKAVTSKVRNAEFKVSKNSTSFKNPRRLEIKDGRSLFLRNRGKIHSGVLSSIESDLKKREQASKSKKSWLNRLNNWLFGWNDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.29
4 0.26
5 0.26
6 0.22
7 0.22
8 0.22
9 0.22
10 0.22
11 0.23
12 0.24
13 0.3
14 0.35
15 0.41
16 0.47
17 0.53
18 0.55
19 0.55
20 0.58
21 0.57
22 0.61
23 0.63
24 0.62
25 0.56
26 0.57
27 0.54
28 0.51
29 0.48
30 0.41
31 0.35
32 0.31
33 0.31
34 0.3
35 0.32
36 0.3
37 0.26
38 0.23
39 0.2
40 0.23
41 0.25
42 0.21
43 0.19
44 0.19
45 0.21
46 0.24
47 0.23
48 0.24
49 0.2
50 0.22
51 0.22
52 0.21
53 0.19
54 0.16
55 0.16
56 0.12
57 0.17
58 0.16
59 0.18
60 0.18
61 0.18
62 0.18
63 0.19
64 0.21
65 0.2
66 0.29
67 0.34
68 0.4
69 0.44
70 0.47
71 0.53
72 0.56
73 0.61
74 0.61
75 0.62
76 0.65
77 0.7
78 0.69
79 0.64
80 0.62
81 0.56
82 0.55
83 0.46
84 0.37
85 0.36
86 0.4
87 0.43
88 0.38
89 0.36
90 0.29
91 0.28
92 0.3
93 0.24
94 0.24
95 0.2
96 0.2
97 0.2
98 0.2
99 0.2
100 0.17
101 0.18
102 0.12
103 0.12
104 0.14
105 0.14
106 0.13
107 0.14
108 0.15
109 0.15
110 0.15
111 0.14
112 0.2
113 0.25
114 0.28
115 0.35
116 0.4
117 0.41
118 0.49
119 0.54
120 0.53
121 0.58
122 0.63
123 0.61
124 0.58
125 0.57
126 0.54
127 0.51
128 0.45
129 0.37
130 0.34
131 0.29
132 0.26
133 0.25
134 0.2
135 0.17
136 0.16
137 0.15
138 0.11
139 0.11
140 0.09
141 0.08
142 0.08
143 0.08
144 0.07
145 0.06
146 0.07
147 0.07
148 0.14
149 0.15
150 0.16
151 0.15
152 0.16
153 0.18
154 0.17
155 0.23
156 0.23
157 0.28
158 0.28
159 0.3
160 0.31
161 0.29
162 0.29
163 0.23
164 0.2
165 0.15
166 0.14
167 0.16
168 0.16
169 0.16
170 0.18
171 0.17
172 0.15
173 0.17
174 0.17
175 0.14
176 0.15
177 0.15
178 0.14
179 0.13
180 0.11
181 0.11
182 0.12
183 0.11
184 0.08
185 0.12
186 0.12
187 0.12
188 0.15
189 0.17
190 0.16
191 0.19
192 0.21
193 0.25
194 0.28
195 0.29
196 0.29
197 0.3
198 0.37
199 0.39
200 0.4
201 0.36
202 0.38
203 0.39
204 0.38
205 0.38
206 0.33
207 0.31
208 0.34
209 0.31
210 0.28
211 0.28
212 0.3
213 0.28
214 0.28
215 0.3
216 0.28
217 0.29
218 0.29
219 0.28
220 0.24
221 0.22
222 0.19
223 0.16
224 0.11
225 0.08
226 0.07
227 0.06
228 0.06
229 0.05
230 0.05
231 0.07
232 0.08
233 0.09
234 0.09
235 0.09
236 0.09
237 0.09
238 0.09
239 0.07
240 0.06
241 0.05
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.05
250 0.05
251 0.05
252 0.06
253 0.07
254 0.07
255 0.06
256 0.06
257 0.05
258 0.06
259 0.05
260 0.05
261 0.04
262 0.05
263 0.06
264 0.06
265 0.06
266 0.06
267 0.06
268 0.08
269 0.08
270 0.1
271 0.16
272 0.19
273 0.22
274 0.33
275 0.35
276 0.42
277 0.52
278 0.56
279 0.55
280 0.59
281 0.6
282 0.5
283 0.5
284 0.45
285 0.43
286 0.43
287 0.4
288 0.35
289 0.35
290 0.36
291 0.35
292 0.32
293 0.25
294 0.24
295 0.21
296 0.21
297 0.21
298 0.2
299 0.2
300 0.2
301 0.2
302 0.17
303 0.18
304 0.17
305 0.15
306 0.16
307 0.21
308 0.28
309 0.31
310 0.37
311 0.37
312 0.42
313 0.47
314 0.46
315 0.42
316 0.37
317 0.36
318 0.3
319 0.29
320 0.21
321 0.13
322 0.12
323 0.11
324 0.08
325 0.04
326 0.04
327 0.04
328 0.04
329 0.04
330 0.05
331 0.04
332 0.05
333 0.06
334 0.07
335 0.1
336 0.1
337 0.1
338 0.13
339 0.2
340 0.24
341 0.25
342 0.25
343 0.25
344 0.27
345 0.29
346 0.3
347 0.3
348 0.32
349 0.37
350 0.41
351 0.4
352 0.38
353 0.38
354 0.35
355 0.3
356 0.26
357 0.24
358 0.23
359 0.26
360 0.28
361 0.29
362 0.28
363 0.31
364 0.35
365 0.36
366 0.4
367 0.38
368 0.38
369 0.4
370 0.4
371 0.43
372 0.41
373 0.43
374 0.39
375 0.39
376 0.43
377 0.41
378 0.45
379 0.38
380 0.35
381 0.35
382 0.38
383 0.46
384 0.45
385 0.51
386 0.52
387 0.58
388 0.6
389 0.56
390 0.59
391 0.55
392 0.54
393 0.56
394 0.54
395 0.51
396 0.51
397 0.51
398 0.46
399 0.51
400 0.56
401 0.55
402 0.62
403 0.61
404 0.66
405 0.69
406 0.68
407 0.67
408 0.68
409 0.66
410 0.65
411 0.65
412 0.58
413 0.54
414 0.53
415 0.48
416 0.48
417 0.49
418 0.44
419 0.47
420 0.5
421 0.51
422 0.5
423 0.49
424 0.44
425 0.37
426 0.35
427 0.32
428 0.28
429 0.24
430 0.24
431 0.23
432 0.18
433 0.19
434 0.23
435 0.25
436 0.29
437 0.32
438 0.4
439 0.45
440 0.56
441 0.64
442 0.69
443 0.72
444 0.77
445 0.79
446 0.77
447 0.8
448 0.79
449 0.79
450 0.77
451 0.82
452 0.77
453 0.75
454 0.68
455 0.62