FuNGI

Q03790

Protein Details

Accession

Q03790

Localization Confidence

Low

Confidence Score

9.7

NoLS Segment(s)

Position	Sequence	Protein Nature
447-470	DLKKREQASKSKKSWLNRLNNWLF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 17.5, cyto_nucl 12, cyto 5.5, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR017389 Nucleoporin_NUP53 IPR012677 Nucleotide-bd_a/b_plait_sf IPR035979 RBD_domain_sf IPR007846 RRM_NUP35_dom
Gene Ontology	GO:0005635 C:nuclear envelope GO:0031965 C:nuclear membrane GO:0005643 C:nuclear pore GO:0044613 C:nuclear pore central transport channel GO:0044615 C:nuclear pore nuclear basket GO:0042802 F:identical protein binding GO:0005543 F:phospholipid binding GO:0003697 F:single-stranded DNA binding GO:0017056 F:structural constituent of nuclear pore GO:0007049 P:cell cycle GO:0051301 P:cell division GO:0051028 P:mRNA transport GO:0006607 P:NLS-bearing protein import into nucleus GO:0006999 P:nuclear pore organization GO:0006913 P:nucleocytoplasmic transport GO:0045893 P:positive regulation of DNA-templated transcription GO:0006606 P:protein import into nucleus GO:0034501 P:protein localization to kinetochore GO:0007088 P:regulation of mitotic nuclear division GO:0060188 P:regulation of protein desumoylation GO:0072417 P:response to spindle checkpoint signaling
KEGG	sce:YMR153W -
Pfam	View protein in Pfam PF05172 Nup35_RRM
PROSITE	View protein in PROSITE PS51472 RRM_NUP35
CDD	cd12721 RRM_Nup53p_fungi

Amino Acid Sequences

MADLQKQENSSRFTNVSVIAPESQGQHEQQKQQEQLEQQKQPTGLLKGLNGFPSAPQPLFMEDPPSTVSGELNDNPAWFNNPRKRAIPNSIIKRSNGQSLSPVRSDSADVPAFSNSNGFNNVTFGSKKDPRILKNVSPNDNNSANNNAHSSDLGTVVFDSNEAPPKTSLADWQKEDGIFSSKTDNIEDPNLSSNITFDGKPTATPSPFRPLEKTSRILNFFDKNTKTTPNTASSEASAGSKEGASTNWDDHAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSLTAQKYPIYTGDGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSPAALKQLASLKKSEEIINNKTSSQTSLSSKDLSNYRKTEGIFEKAKAKAVTSKVRNAEFKVSKNSTSFKNPRRLEIKDGRSLFLRNRGKIHSGVLSSIESDLKKREQASKSKKSWLNRLNNWLFGWNDL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.32
3	0.29
4	0.26
5	0.26
6	0.22
7	0.22
8	0.22
9	0.22
10	0.22
11	0.23
12	0.24
13	0.3
14	0.35
15	0.41
16	0.47
17	0.53
18	0.55
19	0.55
20	0.58
21	0.57
22	0.61
23	0.63
24	0.62
25	0.56
26	0.57
27	0.54
28	0.51
29	0.48
30	0.41
31	0.35
32	0.31
33	0.31
34	0.3
35	0.32
36	0.3
37	0.26
38	0.23
39	0.2
40	0.23
41	0.25
42	0.21
43	0.19
44	0.19
45	0.21
46	0.24
47	0.23
48	0.24
49	0.2
50	0.22
51	0.22
52	0.21
53	0.19
54	0.16
55	0.16
56	0.12
57	0.17
58	0.16
59	0.18
60	0.18
61	0.18
62	0.18
63	0.19
64	0.21
65	0.2
66	0.29
67	0.34
68	0.4
69	0.44
70	0.47
71	0.53
72	0.56
73	0.61
74	0.61
75	0.62
76	0.65
77	0.7
78	0.69
79	0.64
80	0.62
81	0.56
82	0.55
83	0.46
84	0.37
85	0.36
86	0.4
87	0.43
88	0.38
89	0.36
90	0.29
91	0.28
92	0.3
93	0.24
94	0.24
95	0.2
96	0.2
97	0.2
98	0.2
99	0.2
100	0.17
101	0.18
102	0.12
103	0.12
104	0.14
105	0.14
106	0.13
107	0.14
108	0.15
109	0.15
110	0.15
111	0.14
112	0.2
113	0.25
114	0.28
115	0.35
116	0.4
117	0.41
118	0.49
119	0.54
120	0.53
121	0.58
122	0.63
123	0.61
124	0.58
125	0.57
126	0.54
127	0.51
128	0.45
129	0.37
130	0.34
131	0.29
132	0.26
133	0.25
134	0.2
135	0.17
136	0.16
137	0.15
138	0.11
139	0.11
140	0.09
141	0.08
142	0.08
143	0.08
144	0.07
145	0.06
146	0.07
147	0.07
148	0.14
149	0.15
150	0.16
151	0.15
152	0.16
153	0.18
154	0.17
155	0.23
156	0.23
157	0.28
158	0.28
159	0.3
160	0.31
161	0.29
162	0.29
163	0.23
164	0.2
165	0.15
166	0.14
167	0.16
168	0.16
169	0.16
170	0.18
171	0.17
172	0.15
173	0.17
174	0.17
175	0.14
176	0.15
177	0.15
178	0.14
179	0.13
180	0.11
181	0.11
182	0.12
183	0.11
184	0.08
185	0.12
186	0.12
187	0.12
188	0.15
189	0.17
190	0.16
191	0.19
192	0.21
193	0.25
194	0.28
195	0.29
196	0.29
197	0.3
198	0.37
199	0.39
200	0.4
201	0.36
202	0.38
203	0.39
204	0.38
205	0.38
206	0.33
207	0.31
208	0.34
209	0.31
210	0.28
211	0.28
212	0.3
213	0.28
214	0.28
215	0.3
216	0.28
217	0.29
218	0.29
219	0.28
220	0.24
221	0.22
222	0.19
223	0.16
224	0.11
225	0.08
226	0.07
227	0.06
228	0.06
229	0.05
230	0.05
231	0.07
232	0.08
233	0.09
234	0.09
235	0.09
236	0.09
237	0.09
238	0.09
239	0.07
240	0.06
241	0.05
242	0.04
243	0.04
244	0.04
245	0.04
246	0.04
247	0.04
248	0.05
249	0.05
250	0.05
251	0.05
252	0.06
253	0.07
254	0.07
255	0.06
256	0.06
257	0.05
258	0.06
259	0.05
260	0.05
261	0.04
262	0.05
263	0.06
264	0.06
265	0.06
266	0.06
267	0.06
268	0.08
269	0.08
270	0.1
271	0.16
272	0.19
273	0.22
274	0.33
275	0.35
276	0.42
277	0.52
278	0.56
279	0.55
280	0.59
281	0.6
282	0.5
283	0.5
284	0.45
285	0.43
286	0.43
287	0.4
288	0.35
289	0.35
290	0.36
291	0.35
292	0.32
293	0.25
294	0.24
295	0.21
296	0.21
297	0.21
298	0.2
299	0.2
300	0.2
301	0.2
302	0.17
303	0.18
304	0.17
305	0.15
306	0.16
307	0.21
308	0.28
309	0.31
310	0.37
311	0.37
312	0.42
313	0.47
314	0.46
315	0.42
316	0.37
317	0.36
318	0.3
319	0.29
320	0.21
321	0.13
322	0.12
323	0.11
324	0.08
325	0.04
326	0.04
327	0.04
328	0.04
329	0.04
330	0.05
331	0.04
332	0.05
333	0.06
334	0.07
335	0.1
336	0.1
337	0.1
338	0.13
339	0.2
340	0.24
341	0.25
342	0.25
343	0.25
344	0.27
345	0.29
346	0.3
347	0.3
348	0.32
349	0.37
350	0.41
351	0.4
352	0.38
353	0.38
354	0.35
355	0.3
356	0.26
357	0.24
358	0.23
359	0.26
360	0.28
361	0.29
362	0.28
363	0.31
364	0.35
365	0.36
366	0.4
367	0.38
368	0.38
369	0.4
370	0.4
371	0.43
372	0.41
373	0.43
374	0.39
375	0.39
376	0.43
377	0.41
378	0.45
379	0.38
380	0.35
381	0.35
382	0.38
383	0.46
384	0.45
385	0.51
386	0.52
387	0.58
388	0.6
389	0.56
390	0.59
391	0.55
392	0.54
393	0.56
394	0.54
395	0.51
396	0.51
397	0.51
398	0.46
399	0.51
400	0.56
401	0.55
402	0.62
403	0.61
404	0.66
405	0.69
406	0.68
407	0.67
408	0.68
409	0.66
410	0.65
411	0.65
412	0.58
413	0.54
414	0.53
415	0.48
416	0.48
417	0.49
418	0.44
419	0.47
420	0.5
421	0.51
422	0.5
423	0.49
424	0.44
425	0.37
426	0.35
427	0.32
428	0.28
429	0.24
430	0.24
431	0.23
432	0.18
433	0.19
434	0.23
435	0.25
436	0.29
437	0.32
438	0.4
439	0.45
440	0.56
441	0.64
442	0.69
443	0.72
444	0.77
445	0.79
446	0.77
447	0.8
448	0.79
449	0.79
450	0.77
451	0.82
452	0.77
453	0.75
454	0.68
455	0.62

Q03790

3D AlphaFold-predicted Structure Viewer