Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53903

Protein Details
Accession P53903    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-105TTSFGWGKKTRRRVKRQQELFENALHydrophilic
NLS Segment(s)
PositionSequence
89-93KTRRR
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0005635  C:nuclear envelope  
GO:0031965  C:nuclear membrane  
GO:0015031  P:protein transport  
KEGG sce:YNL149C  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSEVAETWVDTWMAKLVNYDYKHFIRLVIIVGGYLLLRNIASRELAKKQLAAQVEKDKRDKEEKRSKDLIDKPDDAATAETTSFGWGKKTRRRVKRQQELFENALEEAKRRNQGLDPDSDADIEELLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.21
5 0.24
6 0.26
7 0.3
8 0.31
9 0.33
10 0.31
11 0.28
12 0.22
13 0.21
14 0.19
15 0.14
16 0.12
17 0.1
18 0.1
19 0.09
20 0.07
21 0.06
22 0.04
23 0.03
24 0.03
25 0.04
26 0.05
27 0.05
28 0.07
29 0.09
30 0.13
31 0.16
32 0.21
33 0.21
34 0.21
35 0.23
36 0.25
37 0.26
38 0.24
39 0.25
40 0.31
41 0.35
42 0.37
43 0.39
44 0.36
45 0.37
46 0.45
47 0.46
48 0.46
49 0.52
50 0.53
51 0.58
52 0.61
53 0.58
54 0.58
55 0.59
56 0.55
57 0.5
58 0.47
59 0.4
60 0.37
61 0.36
62 0.27
63 0.22
64 0.15
65 0.11
66 0.09
67 0.08
68 0.07
69 0.08
70 0.09
71 0.08
72 0.11
73 0.16
74 0.24
75 0.32
76 0.43
77 0.52
78 0.62
79 0.72
80 0.79
81 0.85
82 0.88
83 0.9
84 0.88
85 0.87
86 0.83
87 0.74
88 0.65
89 0.54
90 0.43
91 0.36
92 0.27
93 0.2
94 0.18
95 0.22
96 0.25
97 0.24
98 0.27
99 0.29
100 0.37
101 0.4
102 0.41
103 0.4
104 0.38
105 0.38
106 0.36
107 0.32
108 0.23
109 0.19