Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P43574

Protein Details
Accession P43574    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
267-288KPGSRRNSSVRKKKPALKKIKSBasic
NLS Segment(s)
PositionSequence
267-287KPGSRRNSSVRKKKPALKKIK
Subcellular Location(s) nucl 12.5, cyto_nucl 8, extr 5, E.R. 3, cyto 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013860  AreA_GATA  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0090294  P:nitrogen catabolite activation of transcription  
GO:0001080  P:nitrogen catabolite activation of transcription from RNA polymerase II promoter  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
KEGG sce:YFL021W  -  
Pfam View protein in Pfam  
PF08550  DUF1752  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MHVFFPLLFRPSPVLFIACAYIYIDIYIHCTRCTVVNITMSTNRVPNLDPDLNLNKEIWDLYSSAQKILPDSNRILNLSWRLHNRTSFHRINRIMQHSNSIMDFSASPFASGVNAAGPGNNDLDDTDTDNQQFFLSDMNLNGSSVFENVFDDDDDDDDVETHSIVHSDLLNDMDSASQRASHNASGFPNFLDTSCSSSFDDHFIFTNNLPFLNNNSINNNHSHNSSHNNNSPSIANNTNANTNTNTSASTNTNSPLLRRNPSPSIVKPGSRRNSSVRKKKPALKKIKSSTSVQSSATPPSNTSSNPDIKCSNCTTSTTPLWRKDPKGLPLCNACGLFLKLHGVTRPLSLKTDIIKKRQRSSTKINNNITPPPSSSLNPGAAGKKKNYTASVAASKRKNSLNIVAPLKSQDIPIPKIASPSIPQYLRSNTRHHLSSSVPIEAETFSSFRPDMNMTMNMNLHNASTSSFNNEAFWKPLDSAIDHHSGDTNPNSNMNTTPNGNLSLDWLNLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.2
4 0.2
5 0.15
6 0.15
7 0.13
8 0.12
9 0.11
10 0.1
11 0.1
12 0.08
13 0.14
14 0.18
15 0.18
16 0.17
17 0.18
18 0.18
19 0.21
20 0.25
21 0.24
22 0.24
23 0.29
24 0.31
25 0.34
26 0.37
27 0.36
28 0.34
29 0.32
30 0.28
31 0.24
32 0.24
33 0.23
34 0.28
35 0.29
36 0.27
37 0.31
38 0.37
39 0.37
40 0.37
41 0.34
42 0.25
43 0.23
44 0.23
45 0.18
46 0.13
47 0.12
48 0.12
49 0.2
50 0.2
51 0.2
52 0.22
53 0.21
54 0.21
55 0.28
56 0.31
57 0.28
58 0.31
59 0.34
60 0.35
61 0.36
62 0.35
63 0.33
64 0.36
65 0.36
66 0.38
67 0.4
68 0.43
69 0.46
70 0.51
71 0.49
72 0.5
73 0.55
74 0.57
75 0.56
76 0.6
77 0.6
78 0.62
79 0.67
80 0.66
81 0.63
82 0.56
83 0.55
84 0.47
85 0.45
86 0.37
87 0.3
88 0.22
89 0.17
90 0.16
91 0.12
92 0.15
93 0.13
94 0.13
95 0.12
96 0.12
97 0.11
98 0.11
99 0.1
100 0.06
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.1
107 0.09
108 0.09
109 0.08
110 0.1
111 0.1
112 0.14
113 0.14
114 0.15
115 0.16
116 0.16
117 0.16
118 0.14
119 0.13
120 0.09
121 0.09
122 0.09
123 0.1
124 0.1
125 0.12
126 0.12
127 0.12
128 0.12
129 0.11
130 0.09
131 0.09
132 0.09
133 0.06
134 0.07
135 0.07
136 0.08
137 0.07
138 0.08
139 0.08
140 0.08
141 0.08
142 0.08
143 0.07
144 0.06
145 0.07
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.07
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.08
163 0.07
164 0.1
165 0.1
166 0.12
167 0.15
168 0.16
169 0.17
170 0.19
171 0.2
172 0.19
173 0.19
174 0.17
175 0.16
176 0.14
177 0.12
178 0.13
179 0.12
180 0.16
181 0.16
182 0.18
183 0.17
184 0.18
185 0.19
186 0.18
187 0.18
188 0.13
189 0.13
190 0.13
191 0.13
192 0.13
193 0.15
194 0.13
195 0.12
196 0.12
197 0.12
198 0.13
199 0.19
200 0.2
201 0.18
202 0.2
203 0.22
204 0.23
205 0.25
206 0.25
207 0.19
208 0.18
209 0.18
210 0.18
211 0.22
212 0.25
213 0.28
214 0.31
215 0.31
216 0.31
217 0.31
218 0.29
219 0.25
220 0.25
221 0.21
222 0.17
223 0.17
224 0.17
225 0.19
226 0.19
227 0.18
228 0.15
229 0.15
230 0.16
231 0.14
232 0.14
233 0.11
234 0.13
235 0.13
236 0.13
237 0.13
238 0.12
239 0.14
240 0.14
241 0.14
242 0.19
243 0.21
244 0.23
245 0.24
246 0.29
247 0.28
248 0.32
249 0.36
250 0.3
251 0.35
252 0.34
253 0.36
254 0.36
255 0.43
256 0.46
257 0.44
258 0.46
259 0.45
260 0.53
261 0.59
262 0.65
263 0.65
264 0.68
265 0.72
266 0.78
267 0.81
268 0.8
269 0.82
270 0.79
271 0.8
272 0.78
273 0.79
274 0.74
275 0.67
276 0.62
277 0.57
278 0.51
279 0.42
280 0.37
281 0.31
282 0.31
283 0.3
284 0.25
285 0.19
286 0.19
287 0.2
288 0.17
289 0.19
290 0.21
291 0.26
292 0.26
293 0.28
294 0.29
295 0.29
296 0.32
297 0.31
298 0.29
299 0.23
300 0.26
301 0.26
302 0.29
303 0.32
304 0.36
305 0.39
306 0.41
307 0.46
308 0.49
309 0.49
310 0.53
311 0.54
312 0.55
313 0.57
314 0.54
315 0.52
316 0.5
317 0.49
318 0.43
319 0.37
320 0.29
321 0.22
322 0.22
323 0.17
324 0.13
325 0.14
326 0.12
327 0.13
328 0.13
329 0.13
330 0.13
331 0.16
332 0.19
333 0.18
334 0.19
335 0.19
336 0.21
337 0.23
338 0.32
339 0.35
340 0.41
341 0.48
342 0.52
343 0.59
344 0.66
345 0.69
346 0.67
347 0.71
348 0.73
349 0.75
350 0.79
351 0.75
352 0.71
353 0.68
354 0.66
355 0.58
356 0.49
357 0.4
358 0.34
359 0.32
360 0.27
361 0.28
362 0.27
363 0.26
364 0.25
365 0.26
366 0.28
367 0.31
368 0.34
369 0.33
370 0.34
371 0.36
372 0.39
373 0.38
374 0.37
375 0.35
376 0.36
377 0.42
378 0.42
379 0.46
380 0.47
381 0.47
382 0.48
383 0.48
384 0.46
385 0.41
386 0.43
387 0.44
388 0.47
389 0.48
390 0.45
391 0.41
392 0.4
393 0.38
394 0.31
395 0.24
396 0.21
397 0.23
398 0.25
399 0.28
400 0.3
401 0.28
402 0.3
403 0.3
404 0.28
405 0.24
406 0.27
407 0.3
408 0.27
409 0.29
410 0.31
411 0.39
412 0.44
413 0.46
414 0.47
415 0.45
416 0.49
417 0.49
418 0.46
419 0.42
420 0.36
421 0.4
422 0.37
423 0.34
424 0.29
425 0.26
426 0.26
427 0.23
428 0.21
429 0.15
430 0.13
431 0.11
432 0.15
433 0.15
434 0.14
435 0.17
436 0.17
437 0.18
438 0.21
439 0.26
440 0.24
441 0.28
442 0.29
443 0.27
444 0.26
445 0.23
446 0.19
447 0.15
448 0.14
449 0.11
450 0.13
451 0.13
452 0.18
453 0.2
454 0.2
455 0.21
456 0.24
457 0.25
458 0.25
459 0.26
460 0.22
461 0.21
462 0.23
463 0.24
464 0.23
465 0.24
466 0.25
467 0.29
468 0.27
469 0.26
470 0.26
471 0.24
472 0.28
473 0.29
474 0.29
475 0.25
476 0.28
477 0.29
478 0.28
479 0.29
480 0.29
481 0.28
482 0.26
483 0.28
484 0.27
485 0.29
486 0.27
487 0.25
488 0.25
489 0.24
490 0.22