Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1SYG5

Protein Details
Accession A0A0A1SYG5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-69DENGRRRRWRRRETVETQNGBasic
NLS Segment(s)
PositionSequence
55-59RRRWR
Subcellular Location(s) extr 12, plas 8, E.R. 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Amino Acid Sequences MPPHLHPRSRMTSSLFATTVLASFFVVAMPHLLPCPVPRTKYADGEVVVDENGRRRRWRRRETVETQNGIVQFNQTSDDASPESTSRVCPVPKPGGILGEWLGFHKADDQLSRRADR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.29
5 0.26
6 0.21
7 0.14
8 0.11
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.14
23 0.15
24 0.17
25 0.19
26 0.27
27 0.3
28 0.34
29 0.34
30 0.32
31 0.29
32 0.29
33 0.26
34 0.19
35 0.16
36 0.12
37 0.1
38 0.13
39 0.17
40 0.18
41 0.23
42 0.29
43 0.4
44 0.5
45 0.6
46 0.64
47 0.68
48 0.76
49 0.78
50 0.82
51 0.78
52 0.69
53 0.6
54 0.52
55 0.43
56 0.34
57 0.28
58 0.18
59 0.1
60 0.09
61 0.1
62 0.08
63 0.09
64 0.08
65 0.1
66 0.1
67 0.1
68 0.11
69 0.1
70 0.11
71 0.11
72 0.11
73 0.12
74 0.16
75 0.16
76 0.18
77 0.25
78 0.3
79 0.3
80 0.34
81 0.32
82 0.3
83 0.29
84 0.29
85 0.23
86 0.18
87 0.17
88 0.15
89 0.15
90 0.13
91 0.13
92 0.14
93 0.15
94 0.16
95 0.22
96 0.25
97 0.31