Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1TB80

Protein Details
Accession A0A0A1TB80    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-59GPSGNKKQKDSKTQPRKQPTQDEMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, E.R. 5, mito 4, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009445  TMEM85/Emc4  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF06417  DUF1077  
Amino Acid Sequences MAVSESKMPSWVSQLEAPPAAKSKIPGIVDPVGFGGPSGNKKQKDSKTQPRKQPTQDEMDTLKVKKAWEVALGPVKGLPMTFIMMYMSGNSLQIFSIMMVFMAFKNPIVGLMATNQAFERFQTETNSGKILQTKLIYIVMQLLALGVGIWKINGMGLLPTTRSDWLMWEAQREPVEFAIPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.29
4 0.29
5 0.27
6 0.28
7 0.26
8 0.23
9 0.22
10 0.22
11 0.26
12 0.26
13 0.25
14 0.27
15 0.3
16 0.29
17 0.28
18 0.25
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.15
25 0.22
26 0.29
27 0.31
28 0.36
29 0.45
30 0.51
31 0.59
32 0.65
33 0.69
34 0.73
35 0.8
36 0.86
37 0.86
38 0.86
39 0.83
40 0.82
41 0.76
42 0.73
43 0.65
44 0.59
45 0.51
46 0.47
47 0.43
48 0.34
49 0.31
50 0.24
51 0.23
52 0.21
53 0.21
54 0.17
55 0.17
56 0.17
57 0.19
58 0.23
59 0.23
60 0.21
61 0.19
62 0.18
63 0.15
64 0.14
65 0.1
66 0.05
67 0.06
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.04
88 0.04
89 0.05
90 0.05
91 0.04
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.05
98 0.06
99 0.1
100 0.09
101 0.1
102 0.1
103 0.1
104 0.09
105 0.09
106 0.11
107 0.09
108 0.11
109 0.14
110 0.17
111 0.18
112 0.19
113 0.21
114 0.19
115 0.19
116 0.21
117 0.19
118 0.2
119 0.18
120 0.18
121 0.18
122 0.18
123 0.16
124 0.13
125 0.14
126 0.1
127 0.09
128 0.08
129 0.07
130 0.05
131 0.05
132 0.05
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.04
142 0.05
143 0.07
144 0.08
145 0.09
146 0.1
147 0.12
148 0.13
149 0.14
150 0.13
151 0.15
152 0.18
153 0.23
154 0.23
155 0.26
156 0.27
157 0.31
158 0.33
159 0.31
160 0.3
161 0.24
162 0.25