Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1T541

Protein Details
Accession A0A0A1T541   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
210-231GVDSWRKRRGFITKKNKKEMDGBasic
NLS Segment(s)
PositionSequence
215-227RKRRGFITKKNKK
Subcellular Location(s) mito 16, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR023214  HAD_sf  
IPR010033  HAD_SF_ppase_IIIC  
IPR035679  MDP-1_euk  
IPR010036  MDP_1_eu_arc  
Gene Ontology GO:0016791  F:phosphatase activity  
Pfam View protein in Pfam  
PF12689  Acid_PPase  
CDD cd07501  HAD_MDP-1_like  
Amino Acid Sequences MLRRPSKGNLAAAAAADQPPTPATPIPFSRPNSSSSIPATLLDQSLPLPKLIVFDLDYTLWPFWVDTHVTPPLKPNAHHSAATDRYGEDFSFYRDVPSILQLLPRLQIKMAVASRTSAPSLARELLKLLHLPAERDGDKPRKAIDAFEGGMEIYPGSKIKHMELIHKRTGVPYEDILFFDDESRNRETEKLGVTMQLINSGVSWDEIAKGVDSWRKRRGFITKKNKKEMDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.18
3 0.15
4 0.13
5 0.11
6 0.11
7 0.11
8 0.12
9 0.13
10 0.15
11 0.2
12 0.24
13 0.3
14 0.36
15 0.4
16 0.44
17 0.43
18 0.44
19 0.45
20 0.43
21 0.4
22 0.35
23 0.34
24 0.28
25 0.27
26 0.25
27 0.2
28 0.19
29 0.15
30 0.13
31 0.1
32 0.15
33 0.15
34 0.13
35 0.12
36 0.12
37 0.14
38 0.13
39 0.14
40 0.11
41 0.11
42 0.13
43 0.13
44 0.13
45 0.13
46 0.13
47 0.11
48 0.1
49 0.09
50 0.08
51 0.1
52 0.11
53 0.1
54 0.14
55 0.21
56 0.21
57 0.22
58 0.25
59 0.3
60 0.3
61 0.3
62 0.33
63 0.34
64 0.36
65 0.37
66 0.34
67 0.35
68 0.35
69 0.36
70 0.29
71 0.22
72 0.2
73 0.2
74 0.19
75 0.13
76 0.11
77 0.12
78 0.13
79 0.13
80 0.13
81 0.12
82 0.13
83 0.11
84 0.12
85 0.11
86 0.09
87 0.11
88 0.1
89 0.1
90 0.12
91 0.13
92 0.12
93 0.1
94 0.12
95 0.1
96 0.14
97 0.15
98 0.14
99 0.13
100 0.13
101 0.14
102 0.13
103 0.13
104 0.09
105 0.09
106 0.09
107 0.11
108 0.12
109 0.11
110 0.1
111 0.11
112 0.11
113 0.11
114 0.11
115 0.09
116 0.12
117 0.12
118 0.13
119 0.14
120 0.18
121 0.18
122 0.19
123 0.25
124 0.27
125 0.28
126 0.29
127 0.28
128 0.29
129 0.28
130 0.28
131 0.25
132 0.23
133 0.21
134 0.2
135 0.19
136 0.13
137 0.13
138 0.12
139 0.08
140 0.04
141 0.04
142 0.05
143 0.06
144 0.09
145 0.1
146 0.11
147 0.18
148 0.19
149 0.29
150 0.37
151 0.43
152 0.45
153 0.46
154 0.45
155 0.4
156 0.42
157 0.35
158 0.28
159 0.23
160 0.22
161 0.21
162 0.21
163 0.21
164 0.18
165 0.15
166 0.15
167 0.16
168 0.15
169 0.17
170 0.19
171 0.19
172 0.19
173 0.2
174 0.2
175 0.22
176 0.23
177 0.22
178 0.2
179 0.21
180 0.21
181 0.22
182 0.2
183 0.18
184 0.16
185 0.13
186 0.13
187 0.12
188 0.11
189 0.09
190 0.09
191 0.07
192 0.07
193 0.08
194 0.09
195 0.09
196 0.1
197 0.13
198 0.2
199 0.27
200 0.33
201 0.42
202 0.45
203 0.46
204 0.53
205 0.6
206 0.65
207 0.69
208 0.73
209 0.74
210 0.81
211 0.89