Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38987

Protein Details
Accession P38987   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
210-232GQQHRHHNKSQDRKSHNIRKPSSBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 6.5, mito 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR017231  Small_GTPase_Tem1/Spg1  
Gene Ontology GO:0005816  C:spindle pole body  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0044877  F:protein-containing complex binding  
GO:0051301  P:cell division  
GO:0040001  P:establishment of mitotic spindle localization  
GO:0031578  P:mitotic spindle orientation checkpoint signaling  
GO:1904750  P:negative regulation of protein localization to nucleolus  
GO:0031536  P:positive regulation of exit from mitosis  
GO:0140281  P:positive regulation of mitotic division septum assembly  
GO:0023056  P:positive regulation of signaling  
GO:1902542  P:regulation of protein localization to mitotic spindle pole body  
KEGG sce:YML064C  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
CDD cd04128  Spg1  
Amino Acid Sequences MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPSPGVNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.25
4 0.24
5 0.26
6 0.23
7 0.22
8 0.21
9 0.16
10 0.14
11 0.12
12 0.12
13 0.08
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.09
22 0.09
23 0.11
24 0.13
25 0.13
26 0.18
27 0.22
28 0.24
29 0.26
30 0.26
31 0.29
32 0.32
33 0.32
34 0.28
35 0.26
36 0.24
37 0.21
38 0.23
39 0.18
40 0.2
41 0.22
42 0.26
43 0.26
44 0.29
45 0.31
46 0.29
47 0.33
48 0.32
49 0.36
50 0.35
51 0.38
52 0.38
53 0.38
54 0.37
55 0.34
56 0.29
57 0.22
58 0.17
59 0.14
60 0.09
61 0.08
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.06
68 0.07
69 0.06
70 0.09
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.06
77 0.06
78 0.03
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.05
89 0.07
90 0.07
91 0.07
92 0.08
93 0.09
94 0.09
95 0.1
96 0.11
97 0.14
98 0.15
99 0.18
100 0.19
101 0.2
102 0.2
103 0.19
104 0.19
105 0.17
106 0.19
107 0.15
108 0.15
109 0.13
110 0.12
111 0.11
112 0.1
113 0.07
114 0.04
115 0.04
116 0.03
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.07
133 0.07
134 0.07
135 0.09
136 0.11
137 0.12
138 0.14
139 0.16
140 0.18
141 0.21
142 0.2
143 0.2
144 0.21
145 0.22
146 0.19
147 0.19
148 0.17
149 0.14
150 0.14
151 0.12
152 0.09
153 0.1
154 0.1
155 0.1
156 0.11
157 0.15
158 0.19
159 0.25
160 0.31
161 0.3
162 0.29
163 0.3
164 0.3
165 0.28
166 0.27
167 0.21
168 0.23
169 0.24
170 0.24
171 0.22
172 0.22
173 0.2
174 0.17
175 0.17
176 0.1
177 0.11
178 0.11
179 0.1
180 0.1
181 0.1
182 0.1
183 0.09
184 0.09
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.1
194 0.14
195 0.19
196 0.22
197 0.31
198 0.4
199 0.51
200 0.58
201 0.58
202 0.61
203 0.66
204 0.73
205 0.75
206 0.76
207 0.75
208 0.74
209 0.8
210 0.85
211 0.86
212 0.83
213 0.83
214 0.78
215 0.77
216 0.76
217 0.75
218 0.74
219 0.7
220 0.66
221 0.64
222 0.66
223 0.6
224 0.59
225 0.54