Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P39939

Protein Details
Accession P39939   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
81-112ARIVRVRSREDRKNRAPPQRPRFNRDNKVSPAHydrophilic
NLS Segment(s)
PositionSequence
3-19KKRASNGRNKKGRGHVK
87-117RSREDRKNRAPPQRPRFNRDNKVSPAAAAKK
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042255  P:ribosome assembly  
GO:0006407  P:rRNA export from nucleus  
KEGG sce:YER131W  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYPEYALPKTYNKLHYCVSCAIHARIVRVRSREDRKNRAPPQRPRFNRDNKVSPAAAAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.66
11 0.61
12 0.62
13 0.58
14 0.54
15 0.55
16 0.58
17 0.59
18 0.61
19 0.66
20 0.61
21 0.66
22 0.64
23 0.61
24 0.55
25 0.6
26 0.58
27 0.56
28 0.51
29 0.43
30 0.4
31 0.33
32 0.29
33 0.21
34 0.17
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.04
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.09
49 0.09
50 0.1
51 0.09
52 0.11
53 0.14
54 0.18
55 0.25
56 0.25
57 0.28
58 0.3
59 0.3
60 0.31
61 0.32
62 0.29
63 0.24
64 0.26
65 0.24
66 0.25
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.34
74 0.39
75 0.47
76 0.54
77 0.59
78 0.66
79 0.71
80 0.79
81 0.82
82 0.84
83 0.85
84 0.87
85 0.87
86 0.89
87 0.86
88 0.83
89 0.84
90 0.84
91 0.84
92 0.82
93 0.8
94 0.75
95 0.75
96 0.67
97 0.59
98 0.57
99 0.52