Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38374

Protein Details
Accession P38374   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-36NKNNEKYRKYGKKKEGKTEKTBasic
NLS Segment(s)
PositionSequence
21-32KYRKYGKKKEGK
Subcellular Location(s) mito 6, plas 4, extr 4, golg 4, nucl 3, E.R. 3, cyto 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0030968  P:endoplasmic reticulum unfolded protein response  
GO:0006486  P:protein glycosylation  
GO:0009306  P:protein secretion  
KEGG sce:YBR162W-A  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAVQTPRQRLANAKFNKNNEKYRKYGKKKEGKTEKTAPVISKTWLGILLFLLVGGGVLQLISYIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.73
4 0.72
5 0.74
6 0.73
7 0.71
8 0.67
9 0.71
10 0.75
11 0.74
12 0.77
13 0.77
14 0.78
15 0.79
16 0.85
17 0.85
18 0.8
19 0.77
20 0.75
21 0.7
22 0.64
23 0.59
24 0.5
25 0.43
26 0.38
27 0.32
28 0.26
29 0.21
30 0.17
31 0.16
32 0.15
33 0.11
34 0.1
35 0.09
36 0.07
37 0.07
38 0.06
39 0.04
40 0.04
41 0.03
42 0.03
43 0.02
44 0.02
45 0.02