Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P36169

Protein Details
Accession P36169   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-46FWFNLQKRYKREEQDDRELEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, cyto 5, E.R. 4, nucl 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0005933  C:cellular bud  
GO:0033101  C:cellular bud membrane  
GO:0005934  C:cellular bud tip  
GO:0000131  C:incipient cellular bud site  
GO:0031505  P:fungal-type cell wall organization  
KEGG sce:YKR100C  -  
Amino Acid Sequences MTASTSVAVGCAVGIPVGVGIIIAVCFWFNLQKRYKREEQDDRELERAIYDESGFVSFDNFGPLRDSKDEAALASSELKNPDHTSGSSEGSAHPEEKDGKSRDQEKPLGKKNSKYYVPAYRRKINLLQVRNNNYGNNARQKSVVDLPSINNSSNVSLSSSQRHITKRQISVYDQMVPVISDEGPNFFADPSSDTNTSNDQNKASMIELKHNTRQSSNENLIRNLQNQDFGSYYPRRASSSFLNGNISNASFHTRNSSITSVNKRDALEDVFATPKSAAQSQLPNTFDKDNEGMDADHSVKDSRSAITDKDKDLYKLQNNYDVGNIGEIAEEDQYENEFTNYSQSKREFIESLRPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.04
14 0.05
15 0.12
16 0.15
17 0.24
18 0.33
19 0.42
20 0.5
21 0.59
22 0.67
23 0.69
24 0.76
25 0.79
26 0.78
27 0.8
28 0.79
29 0.75
30 0.68
31 0.6
32 0.5
33 0.39
34 0.32
35 0.22
36 0.16
37 0.13
38 0.11
39 0.11
40 0.11
41 0.11
42 0.09
43 0.09
44 0.09
45 0.09
46 0.14
47 0.13
48 0.13
49 0.17
50 0.18
51 0.21
52 0.23
53 0.25
54 0.21
55 0.24
56 0.24
57 0.2
58 0.2
59 0.16
60 0.14
61 0.16
62 0.16
63 0.15
64 0.17
65 0.17
66 0.18
67 0.2
68 0.22
69 0.2
70 0.2
71 0.22
72 0.22
73 0.24
74 0.22
75 0.2
76 0.18
77 0.2
78 0.21
79 0.17
80 0.15
81 0.16
82 0.19
83 0.21
84 0.29
85 0.28
86 0.31
87 0.38
88 0.45
89 0.49
90 0.52
91 0.57
92 0.57
93 0.63
94 0.68
95 0.72
96 0.68
97 0.68
98 0.69
99 0.7
100 0.65
101 0.6
102 0.56
103 0.56
104 0.61
105 0.63
106 0.62
107 0.6
108 0.59
109 0.6
110 0.58
111 0.56
112 0.56
113 0.55
114 0.57
115 0.58
116 0.62
117 0.61
118 0.58
119 0.49
120 0.44
121 0.41
122 0.38
123 0.39
124 0.35
125 0.31
126 0.31
127 0.31
128 0.32
129 0.32
130 0.29
131 0.21
132 0.21
133 0.21
134 0.25
135 0.26
136 0.22
137 0.17
138 0.16
139 0.15
140 0.14
141 0.13
142 0.1
143 0.11
144 0.12
145 0.15
146 0.16
147 0.17
148 0.21
149 0.24
150 0.26
151 0.32
152 0.38
153 0.39
154 0.41
155 0.42
156 0.4
157 0.41
158 0.39
159 0.34
160 0.27
161 0.22
162 0.18
163 0.15
164 0.13
165 0.1
166 0.08
167 0.05
168 0.05
169 0.06
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.06
176 0.08
177 0.1
178 0.13
179 0.14
180 0.14
181 0.16
182 0.18
183 0.2
184 0.22
185 0.21
186 0.17
187 0.17
188 0.17
189 0.16
190 0.14
191 0.16
192 0.13
193 0.19
194 0.22
195 0.26
196 0.31
197 0.33
198 0.34
199 0.31
200 0.34
201 0.31
202 0.35
203 0.37
204 0.37
205 0.36
206 0.36
207 0.39
208 0.38
209 0.36
210 0.32
211 0.26
212 0.24
213 0.22
214 0.23
215 0.19
216 0.17
217 0.21
218 0.2
219 0.21
220 0.2
221 0.21
222 0.22
223 0.22
224 0.25
225 0.24
226 0.31
227 0.33
228 0.31
229 0.34
230 0.31
231 0.32
232 0.29
233 0.24
234 0.16
235 0.13
236 0.15
237 0.12
238 0.13
239 0.17
240 0.17
241 0.19
242 0.22
243 0.23
244 0.23
245 0.3
246 0.38
247 0.37
248 0.39
249 0.4
250 0.37
251 0.36
252 0.35
253 0.3
254 0.24
255 0.2
256 0.19
257 0.17
258 0.17
259 0.17
260 0.14
261 0.14
262 0.14
263 0.15
264 0.15
265 0.17
266 0.24
267 0.28
268 0.35
269 0.35
270 0.34
271 0.35
272 0.35
273 0.32
274 0.29
275 0.26
276 0.2
277 0.19
278 0.19
279 0.16
280 0.15
281 0.17
282 0.14
283 0.13
284 0.14
285 0.14
286 0.13
287 0.15
288 0.16
289 0.14
290 0.17
291 0.19
292 0.22
293 0.31
294 0.35
295 0.35
296 0.38
297 0.4
298 0.39
299 0.42
300 0.47
301 0.45
302 0.49
303 0.49
304 0.53
305 0.51
306 0.49
307 0.45
308 0.37
309 0.29
310 0.22
311 0.19
312 0.11
313 0.1
314 0.09
315 0.08
316 0.08
317 0.08
318 0.07
319 0.08
320 0.09
321 0.09
322 0.1
323 0.09
324 0.1
325 0.09
326 0.18
327 0.21
328 0.22
329 0.29
330 0.3
331 0.34
332 0.37
333 0.41
334 0.36
335 0.36