Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40018

Protein Details
Accession P40018    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-141LSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTBasic
NLS Segment(s)
PositionSequence
105-139KKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKP
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0071013  C:catalytic step 2 spliceosome  
GO:0000243  C:commitment complex  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005681  C:spliceosomal complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0005687  C:U4 snRNP  
GO:0071001  C:U4/U6 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0003723  F:RNA binding  
GO:0036261  P:7-methylguanosine cap hypermethylation  
GO:0000395  P:mRNA 5'-splice site recognition  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0000245  P:spliceosomal complex assembly  
GO:0000387  P:spliceosomal snRNP assembly  
GO:1903241  P:U2-type prespliceosome assembly  
KEGG sce:YER029C  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01717  Sm_B  
Amino Acid Sequences MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.26
4 0.25
5 0.26
6 0.23
7 0.22
8 0.21
9 0.22
10 0.25
11 0.28
12 0.32
13 0.32
14 0.33
15 0.33
16 0.33
17 0.29
18 0.23
19 0.16
20 0.12
21 0.13
22 0.11
23 0.12
24 0.11
25 0.1
26 0.1
27 0.11
28 0.12
29 0.1
30 0.12
31 0.12
32 0.12
33 0.13
34 0.12
35 0.11
36 0.11
37 0.12
38 0.12
39 0.15
40 0.16
41 0.18
42 0.21
43 0.26
44 0.32
45 0.4
46 0.49
47 0.55
48 0.63
49 0.67
50 0.7
51 0.71
52 0.72
53 0.72
54 0.66
55 0.65
56 0.57
57 0.54
58 0.55
59 0.5
60 0.44
61 0.41
62 0.36
63 0.28
64 0.28
65 0.26
66 0.2
67 0.19
68 0.16
69 0.12
70 0.13
71 0.13
72 0.12
73 0.12
74 0.1
75 0.1
76 0.09
77 0.07
78 0.07
79 0.06
80 0.05
81 0.05
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.1
88 0.13
89 0.15
90 0.15
91 0.19
92 0.24
93 0.32
94 0.38
95 0.42
96 0.49
97 0.56
98 0.66
99 0.72
100 0.75
101 0.78
102 0.79
103 0.81
104 0.82
105 0.83
106 0.83
107 0.83
108 0.85
109 0.85
110 0.88
111 0.89
112 0.85
113 0.86
114 0.85
115 0.84
116 0.86
117 0.85
118 0.81
119 0.81
120 0.84
121 0.82
122 0.82
123 0.79
124 0.78
125 0.75
126 0.74
127 0.72
128 0.67
129 0.62
130 0.55
131 0.54
132 0.46
133 0.42
134 0.44
135 0.39
136 0.41
137 0.4
138 0.37
139 0.36
140 0.36
141 0.36
142 0.33
143 0.31
144 0.29
145 0.34
146 0.33
147 0.31
148 0.29
149 0.3
150 0.31
151 0.32
152 0.29
153 0.24
154 0.26
155 0.26
156 0.26
157 0.24
158 0.2
159 0.21
160 0.2
161 0.24
162 0.23
163 0.26
164 0.34
165 0.38
166 0.47
167 0.49
168 0.54
169 0.55
170 0.58
171 0.61
172 0.6
173 0.62
174 0.62
175 0.66
176 0.7