Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P27882

Protein Details
Accession P27882    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
158-185MCEAHNKVNKKLRKPKFDCNFWEKRWKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039799  ALR/ERV  
IPR036774  ERV/ALR_sulphydryl_oxid_sf  
IPR017905  ERV/ALR_sulphydryl_oxidase  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0005739  C:mitochondrion  
GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016971  F:flavin-linked sulfhydryl oxidase activity  
GO:0016972  F:thiol oxidase activity  
GO:0034599  P:cellular response to oxidative stress  
GO:0006879  P:intracellular iron ion homeostasis  
GO:0045041  P:protein import into mitochondrial intermembrane space  
KEGG sce:YGR029W  -  
Pfam View protein in Pfam  
PF04777  Evr1_Alr  
PROSITE View protein in PROSITE  
PS51324  ERV_ALR  
Amino Acid Sequences MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLAGTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.28
5 0.26
6 0.26
7 0.26
8 0.26
9 0.27
10 0.29
11 0.27
12 0.33
13 0.37
14 0.38
15 0.38
16 0.39
17 0.36
18 0.33
19 0.32
20 0.28
21 0.31
22 0.36
23 0.36
24 0.38
25 0.36
26 0.33
27 0.36
28 0.31
29 0.24
30 0.18
31 0.16
32 0.15
33 0.21
34 0.22
35 0.19
36 0.21
37 0.2
38 0.2
39 0.23
40 0.25
41 0.2
42 0.18
43 0.18
44 0.17
45 0.16
46 0.15
47 0.13
48 0.09
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.04
61 0.05
62 0.08
63 0.11
64 0.14
65 0.18
66 0.22
67 0.29
68 0.33
69 0.38
70 0.37
71 0.38
72 0.42
73 0.39
74 0.35
75 0.29
76 0.25
77 0.19
78 0.18
79 0.14
80 0.08
81 0.07
82 0.08
83 0.09
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.08
95 0.1
96 0.13
97 0.17
98 0.18
99 0.2
100 0.23
101 0.26
102 0.29
103 0.32
104 0.29
105 0.27
106 0.27
107 0.26
108 0.25
109 0.22
110 0.2
111 0.16
112 0.19
113 0.15
114 0.15
115 0.15
116 0.15
117 0.23
118 0.21
119 0.22
120 0.23
121 0.26
122 0.31
123 0.33
124 0.39
125 0.37
126 0.38
127 0.42
128 0.44
129 0.42
130 0.39
131 0.37
132 0.35
133 0.33
134 0.34
135 0.32
136 0.28
137 0.28
138 0.27
139 0.25
140 0.23
141 0.21
142 0.19
143 0.16
144 0.17
145 0.17
146 0.22
147 0.26
148 0.32
149 0.39
150 0.42
151 0.5
152 0.58
153 0.64
154 0.67
155 0.74
156 0.75
157 0.78
158 0.81
159 0.84
160 0.85
161 0.86
162 0.84
163 0.83
164 0.82
165 0.77
166 0.8
167 0.7
168 0.67
169 0.66